662 Websites:Organisations:Summaries:Related categories:Related keywords:Related locations:
limousineservicefriesland.nlLimousine Service FrieslandThe website, Limousine Service Friesland, offers limousine rental services in the province of Friesland and surrounding areas, specializing in long limousines and various luxury vehicles with drivers.Personal Transportation → Limousines 71 limousine 117 luxury 375 driver 1832 rental 7257 Northeast-Friesland → Dokkum 846
lunchroommem.nlLunchroom MemLunchroom Mem is a lunchroom and learning/workplace in Joure, Netherlands, with a B&B, focused on creating a welcoming atmosphere and offering support to participants in the work process.Bars → Pubs 546 Hotels → Boutique Hotels 914 father 94 lunchroom 312 mother 603 b&b 1060 guest 1334
kotaradja-beilen.nlRolf BenzThe website showcases a selection of furniture and interior products, as well as advice on gardening design and interior styling.Living & Dining → Sofas 540 Decor & Furnishings → Home Stores 932 coat rack 23 interior design advice 129 sofa 481 garden 13129 Midden-Drenthe → Beilen 498
swandesign.nlSwan DesignSwan Design is an online shop selling handmade jewelry, cushions, and other accessories.Upholstery & Fabrics → Cushions 245 Bedding → Blankets 69 cushion 823 jewelry 4599 webshop 8648 accessories 12975 Southwest-Friesland → Stavoren 155
elanfysio.nlElan Fysio JoureElan Fysio Joure is a physiotherapy practice in Joure that uses a holistic approach to restore the body's balance and promote sustainable recovery.Physical Therapy → Osteopathy 922 shoulder 120 holistic 699 healing 1148 body 3490 physiotherapy 4688 complaint 6479
beautyenderma.nlBeauty & Derma de HaskeThe website of Beauty & Derma de Haske is a skincare specialist with locations in Heerenveen, Oudehaske, and Joure, offering a wide range of skin improvement treatments, cosmetic procedures, and advice on healthy lifestyles.Skincare → Skin Treatment 166 Mental & Emotional Well-Being → Healthy Living 402 bioslimming 16 skin problems 220 skin improvement 1058 health 6366 treatment 21203 De Fryske Marren → Oudehaske 49
chiptuning-feno.nlChiptuning FenoThe website Chiptuning Feno, located in Joure (Friesland), offers chiptuning services for almost all car brands, with a focus on improving vehicle performance through software adjustments.Automotive Maintenance → Chiptuning 229 Agriculture → Agricultural Machinery & Equipment 631 test bench 18 chiptuning 264 engine 758 software 8291 car 10865 brand 17737
dejongyachtcharter.nlDe Jong SloepverhuurDe Jong Sloepverhuur is a sloop rental company located in Friesland that rents sloops without a boating license or deposit.Water Recreation → Sloop Rental 14 TravelBrands → Travel Agencies 1840 friesian lakes 12 sloop 272 fleet 1351 De Fryske Marren → Langweer 93
juwelierariedekoning.nlJuwelier Arie de KoningJuwelier Arie de Koning is a jeweler and online store located in Joure, Friesland, offering watches, jewelry, and baby items.Hobbies → Timepieces 48 baby items 75 watch 1166 jewelry 4599 repair 14576
autoservice-dejouwer.nlAutoservice de JouwerAutoservice de Jouwer is a car service company located in Joure that focuses on providing quality car maintenance and repairs to individuals and business drivers.Car Care & Detailing → Accessories 17 dealership 292 inspection 4279 repair 14576 maintenance 20093
boxzpark.nlBoxzPark B.V.The website of BoxzPark provides information about the rental and sale of multifunctional units in various locations in the Netherlands.Property Sales → Buying a House 872 Office Space → Rental Space 537 unit 405 purchase 2212 rental 7257 De Fryske Marren → Lemmer 1188
halfzwaar.nlHalfzwaarThe website is a personal showcase of creative projects and 3D models, primarily focused on Lego, Arduino, and other repurposed materials.Electronics & Components → Arduino 19 Software Development & Engineering → Game Development 287 blender 56 arduino 123 3d-print 124 lego 341
hoveniersbedrijfweerman.nlHoveniersbedrijf Sander WeermanThis website provides information about the services offered by Hoveniersbedrijf Weerman, including landscaping, garden maintenance, and paving, as well as project examples and contact details.Garden → Paving 1003 Exterior Works → Excavation 316 ceramic tiles 20 garden maintenance 462 landscaping 1529 paving 1942 De Fryske Marren →  Sintjohannesga 24
jdv-lasbedrijf.nlJDV LasbedrijfJDV Lasbedrijf is a welding company offering various welding services, including repairs and construction, and operating in Friesland and Groningen.Manufacturing → Metals & Fabrication 1224 certificate 1036 welding 1051 ship 5103 construction 7421 Northeast-Friesland → Dokkum 846
pizzeria-grillroom-cappadocia-joure.nlPizzeria & Grillroom CappadociaPizzeria & Grillroom Cappadocia is an online restaurant in Joure where customers can order food and place online orders.Food Delivery → Italian Restaurant 1040 Turkish Cuisine → Fast Food 3222 combo meal 65 lahmacun 93 kapsalon 509 sandwich 4098 pizza 4158
omroepmax.nlOmroep MAXThe website of Omroep MAX is a platform for members to support the MAX channel and participate in various activities.Periodical Publications → Magazines 1001 TravelBrands → Tour Operators 363 max 18 outing 982 travel 7210 membership 10442 Vijfheerenlanden → Leerdam 672
de.nlDouwe EgbertsThe website of Douwe Egberts NL offers coffee products and initiatives, with a focus on sustainability and community connection.Volunteering → Community Initiatives 523 Coffee & Tea → Coffee 1064 coffee 3838 history 7286 community 7931 sustainability 18451
hoekstraenpartners.nlHoekstra & Partners NotarissenHoekstra & Partners Notarissen is a collaborative network of notaries with six offices across the Netherlands, providing legal services for various notary matters.Notaries → Notary Office 82 legal services 241 notary 791 address 901 netherlands 1376 office 2898 collaboration 16036 Overijssel → Zwolle 7395
dechristoffel.nlHoly Christoffel ParishThe Christoffel is an online guide for Catholic parishes in Southwest Friesland, providing information on services, activities, and news.Catholic Churches → Dutch Churches 10 Catholic → Parishes 457 sacraments 89 parish 353 news 15293 De Fryske Marren → Balk 224
hisgis.nlHisGISThe HisGIS website provides digital historical maps and information about various regions of the Netherlands, including the coastlines and cities of North Holland and Zeeland.Computer Science → Geographic Information Systems (GIS) 66 Graphic Design & Printing → Graphic Arts 1034 maps 331 city 1875 data 5872 De Fryske Marren → Balk 224
aquacombi.nlAquacombiAquacombi is a supplier of water softening equipment since 1993, offering products, support, and knowledge about water treatment.Water Technology → Water Softening 10 knowledge center 131 water treatment 166 water softener 324 online shop 1310
doppio-espresso.nlDoppio Espresso Holding B.V.Doppio Espresso is a coffee chain offering multiple locations and online options.Food & Beverage → Franchising 254 Beauty → Tanning Beds 237 franchise 284 online shop 1310 coffee 3838 menu 13856 Smallingerland → Drachten 2052
kisgroup.nlKIS Group NederlandThe website of KIS Group Nederland presents lifting and hoisting solutions, services, and expertise in crane construction and CNC machining technology.Industrial Equipment & Services → Machine Building 665 Technical Services → Maintenance Companies 517 cnc machining 56 consulting 3639 maintenance 20093 Sittard-Geleen → Geleen 978
radiospannenburg.nlRadio SpannenburgRadio Spannenburg is a regional radio station providing news, events, and music to the area of De Fryske Marren.Radio → Regional Radio 115 News & Journalism → Regional News 948 skûtsje 57 radio 1200 news 15293 event 45199 De Fryske Marren → Langweer 93
accolade.nlAccoladeThe website provides information about Accolade’s social housing projects, locations, and contact details.Social & Supported Housing → Social Housing 361 social housing 35 rental property 211 repair 14576 Smallingerland → Drachten 2052
veldsink.nlVeldsink AdviesThe website offers financial advice for private situations.Pensions → Pension Planning 234 savings 457 pension 1682 mortgage 4564 insurance 6359 Vijfheerenlanden → Ameide 97
huurportaal.nlHuurportaalHuurportaal.nl is an online platform connecting renters directly with private landlords in the Netherlands.Property Location & Neighborhood → Property 695 Accommodation → Rental Properties 214 owner 515 rent 981 agent 1253 advertisement 1707 apartment 5088 property 7406 Stichtse Vecht → Maarssen 1051
sportbedrijfdfm.nlSportbedrijf De Fryske MarrenSportbedrijf De Fryske Marren is a self-governing community organization dedicated to making sport and movement accessible to everyone in the municipality of De Fryske Marren.Spa → Saunas 920 Body & Movement → Exercise 1005 gym 699 swimming pool 1664 movement 2304 sport 4228 municipality 6837 collaboration 16036
noord-computers.nlNoord ComputersNoord Computers provides a range of computer services, including repairs, cloud solutions, and advice, and now also sells Apple products.Computer → Computer Repair 898 Computer → Computer Support 1003 apple 321 computer 1969 window 2030 security 6655 software 8291
skutsjesilen.nlSKS SkûtsjesilenThis website of SKS Skûtsjesilen presents information about the traditional sailing competition for skûtsjes in Friesland, including a schedule of races, standings, and historical data.Sailing → Traditional Sailing 19 Running → Races 266 skûtsjesilen 17 standings 143 race 1043 sponsors 2642 history 7286 De Fryske Marren → Lemmer 1188
tandarts.nlTandarts.nlThis website provides information about all aspects of oral health, including dental anxiety, emergency treatments, and a list of dentists by location.Adult & Continuing Learning → Professional Development 2080 Health → Medical Care & Services 29461 oral health 686 prevention 1763 dentist 2514 treatment 21203 Pijnacker-Nootdorp → Pijnacker 788
nnhf.nlNoord Nederlandse Handboog FederatieThe Noord Nederlandse Handboog Federatie (NNHF) is a federation that brings together archery clubs in northern Netherlands and supports the organization of competitions and other activities.Shooting → Archery 259 results 3954 club 4225 competition 4759 member 10154 Southwest-Friesland → Sneek 1921
zorggroepsintmaarten.nlZorggroep Sint MaartenThe website of Zorggroep Sint Maarten provides information and services for clients, employees, volunteers, referrers, and potential tenants.Sustainable Living → Housing Associations 325 Rental Properties → Tenant Associations 351 nursing home care 10 rental housing 38 palliative care 140 home care 827 rehabilitation 1512 wellbeing 2620 Dinkelland → Oud Ootmarsum 16
swimfun.nlSwimfunSubtropisch Zwembad Swimfun in Joure is an indoor swimming pool offering water fun and recreation for families and individuals.Parties → Birthday Parties 1008 Water Sports → Water Parks 31 attraction 1275 pool 1532 North-Holland → Amsterdam 41253
hofenhiem.nlZorggroep Hof en HiemThe website of Zorggroep Hof en Hiem presents the services and locations of a care organization focused on home care, residential care, daycare, and other supporting services.Care → Residential Care 305 assisted living 21 home care 827 job vacancies 1241 daycare 1365 volunteer 8367 De Fryske Marren → Balk 224
borgergroep.nlScouting De Borgergroep JoureThe website of Scouting De Borgergroep Joure provides information about the organization, its activities, scout troops, and opportunities to become a member.Youth Organizations → Scouting 1004 Organizations → Community Organization 17 troop 77 age group 93 clubhouse 784 scouting 860 volunteer 8367
mcdonaldsrestaurant.nlMcDonald's NetherlandsThe website aims to provide potential customers with information about the locations of McDonald's restaurants in the Netherlands.Websites → Restaurant Websites 14 TravelContent → Maps 141 address 901 restaurant 11215 The Hague → Scheveningen 1625
sari-fairfashion.nlSari Fair FashionSari Fair Fashion is a store specializing in fair trade clothing, sustainable garments, and accessories with a focus on respect for people and the environment.Coffee → Specialty Coffee 20 Commerce → Fair Trade 191 fairtrade 200 certification 3380 assortment 7799 clothing 9443 sustainability 18451 Overijssel → Dalfsen 1099
madelen.nlMadelen EssensThe website offers computer lessons in programs like Word, Excel, and website creation, with options for in-home instruction or at specific locations.Computer → Computer Support 1003 excel 228 whatsapp 382 ipad 404 internet 1678 De Fryske Marren → Balk 224
trientsje.nlBorduurstudio TrientsjeBorduurstudio Trientsje is an online shop selling embroidery tools and software.Crafts → Handmade 1147 prestashop 42 cart 381 shop 6483 software 8291
westreiniging.nlWEST ReinigingWEST Reiniging is a specialist in exterior cleaning offering a range of cleaning and maintenance services.Maintenance & Services → Facade Maintenance 673 Cleaning Services → Facade Cleaning 418 impregnation 187 graffiti 243 facade 1490 roof 3662 solar panels 4701 Ooststellingwerf → Appelscha 331
deheidepleats.nlNij Abdij de HeidepleatsNij Abdij de Heidepleats is a domain combining vineyards, cheeses, B&B accommodation, and a historic farmstead.Accommodation → B&B 25 Nature → Estates 771 vineyard 260 b&b 1060 estate 1099 cheese 1205 walk 2161 wine 4476 De Fryske Marren → Sint Nicolaasga 146
vitas.nlVitas Holding B.V.Vitas is a company that helps organizations develop software, specifically in the field of Microsoft technology.Cloud Computing → Microsoft Azure 68 Education & Training → Career 1765 microsoft 183 devops 197 azure 222 vacancy 6598 software 8291
trustus.nlTrustusTrustus offers customized wealth management services, specializing in personalized asset development and management.Investing → Wealth Management 435 Personal Wealth → Retirement 769 life insurance 36 wealth management 74 pension 1682 investment 2070 goal 4974
flyingboetoe.nlM.C. Flying BoetoeThe website of M.C. Flying Boetoe, a motorcross and baansport club, provides information about the club, its activities, events, and contact details.Motorsport → Motocross 141 Combat → Badminton 702 motorcross 21 circuit 342 competition 4759 training 28133 event 45199
autodeinum.nlEurorepar Car ServiceThe website of Autoservice Deinum presents the services of an all-round automotive dealership with a specialization in Peugeot and the affiliation with the Eurorepar Car Service network.Motorcycles → Scooters 903 Repair → Engine Repair 129 peugeot 88 part 5044 car 10865 repair 14576 maintenance 20093
hout1893.nlHOUT 1893HOUT 1893 is a company that handcrafts Douglas tables and garden furniture, with a focus on customization and sustainability.Crafts → Handmade 1147 garden furniture 578 customization 1723 sustainability 18451 Tytsjerksteradiel → Burgum 371
pgjoure.nlProtestantse Gemeente JoureThe Protestant Community of Joure provides information about services, events, diaconal measures, pastoral activities and historical data.Protestantism → Reformed 1323 Education & Youth → Local Organization 65 church service 879 schedule 2624 volunteer 8367 event 45199 De Fryske Marren → Goingarijp 86
fotonantko.nlFotograaf NantkoThe website of Fotograaf Nantko in Joure, Friesland, offers a variety of photographic services including passport photos, digital services, photography, printing services (including blueprints), binoculars, canvas prints, and portrait photography, and also offers a copy shop with printing and scanning facilities.Visual Arts → Framing 139 digital services 53 binocular 70 passport photo 227 print 5511 photography 9503
slagerijdejager.nlSlagerij J. de JagerThe website of Slagerij J. de Jager presents the products and services of a traditional butcher shop in the Oppenhuizen and Uitwellingerga region, with a focus on quality and artisanal preparation.Supermarkets & Grocery → Butchers 747 Nature → Waterways 161 artisan 94 sausage 256 beef 319 meal 1638 meat 2055 gift 6442 Southwest-Friesland → Oppenhuizen 41
berendschothoreca.nlBerendschot Horeca Makelaardij en AdviesBerendschot Horeca Makelaardij en Advies is a real estate agency and advisory firm specializing in the sale, acquisition, and valuation of restaurants and cafes.Real Estate → Commercial Property 1840 business coaching 79 inventory 1613 valuation 2697 real estate 4981 restaurant 11215 Steenwijkerland → Belt-Schutsloot 29
baerveldt.nlBaerveldt Beheer B.V.The website presents the activities of several companies, including Baerveldt Beheer B.V., Beleenbank Pandhuys Joure, Van der Meulen Edelmetaal B.V., and Stoeterij Bommelsteyn B.V., and provides links to their individual websites.Animal Husbandry → Horse Breeding 230 precious metal 78 bank 374 silver 479 breed 1744 real estate 4981
springkussenverhuur-leeuwarden.nlSpringkussenverhuur LeeuwardenThe website of Springkussenverhuur Leeuwarden offers rentals of bouncy houses, inflatable slides, party supplies, and more, with a focus on organizing unforgettable parties and events in Leeuwarden and surrounding areas.Outdoor → Play Equipment 313 Rental Services & Equipment → Rental Products 66 bouncy house 42 party supplies 394 party 5928 Northeast-Friesland → Dokkum 846
friesebewakingsdienst.nlFriese bewakingsdienstThe Friese Bewakingsdienst provides security services in Friesland and surrounding areas, including event security, fire watch, and security equipment, via an online store.Context 161394 nightwatch 13 identification 76 webstore 134 festival 3804 security 6655 event 45199 Southwest-Friesland → Bolsward 566
westermarskoalle.nlWestermarskoalleThe website of Westermarskoalle and Ambion is an information resource for parents, students, and visitors, providing details about the school, its mission, curriculum offerings, events, and contact information.Elementary Schools → Public Elementary Schools 406 Higher Learning → Educational Institutions 1049 student 7623 school 7856 education 13471 event 45199 Friesland → Heerenveen 2578
dierenartsenskarsterlan.nlDierenartsen SkarsterlânDierenartsen Skarsterlân is a veterinary practice dedicated to high-quality animal care, with a focus on the well-being of both animals and their owners.Primary Care → Veterinary Medicine 704 Livestock → Animal Husbandry 1106 vaccination 494 veterinarian 864 animal 2908 practice 9089 care 12338 De Fryske Marren → Sint Nicolaasga 146
loodzwaar-media.nlLoodzwaar MediaLoodzwaar Media is a web design and development agency based in Joure, Friesland, specializing in creating custom websites, webshops, and web applications, as well as online marketing services.Web Design & Development → Digital Marketing 998 partner 4272 marketing 7107 webshop 8648 strategy 9379
hdblogistics.nlHdB LogisticsThe website of HdB Logistics describes a logistics service provider specializing in full truck loads (FTL) and less than truckload (LTL) transport, including bulk transport and storage.Logistics → Storage 1170 Transportation Services → Container Transportation 181 bulk 34 storage 2446 logistics 3257 transport 6105
debrugjoure.nlDe Brug JoureDe Brug Joure is a Free Evangelical Church in Joure that offers services and activities.Orchestras → Brass Bands 388 Protestant Churches → Free Evangelical Church 11 number 199
nuovomedia.nlNuovo MediaNuovo Media is an interactive design agency offering services in branding, graphic design, and website development.Design & Creative → Identity 593 online marketing 1085 graphic design 2042 branding 4614 communication 10162 Weststellingwerf → Wolvega 524
delta-impuls.nlDelta ImpulsThe website of Delta Impuls is an information source about the table tennis club with locations in Heerenveen, Joure and Steenwijk. It provides details about the club, members, competitions, training sessions, opening hours, events, and contact information.Sports Clubs → Table Tennis 495 table tennis club 81 competition 4759 membership 10442 news 15293 training 28133 Steenwijkerland → Steenwijk 876
typehelden.nlTypeheldenThe website offers online typing courses, focused on quickly learning to type blind with group learning.Knowledge → Education 69666 exam 2120 teacher 2890 software 8291 course 14728
kjk-grohan.nlKJK Grondverzet, Bestrating, Tuinaanleg, HandelsondernemingKJK is a groundwork, paving, and trading company that performs various garden and paving projects in various locations.Garden → Paving 1003 Land Development & Earthworks → Stabilization 49 driveway 93 groundwork 1348 fence 1814 paving 1942 terrace 4847 garden 13129 Opsterland → Lippenhuizen 41
preventie-werk.nlPreventie&WerkPreventie&Werk is an independent occupational health and accident prevention specialist dedicated to helping organizations structurally reduce absenteeism.Occupational Medicine → Occupational Health Services 60 Insurance & Risk → Risk Management 1060 arbo 155 absenteeism 461 risk 2896 training 28133
museumjoure.nlMuseum JoureMuseum Joure is a surprising maker’s museum that showcases the history of Douwe Egberts and other local crafts in Joure.Museums → Historical Museums 341 clocks 178 café 944 exhibition 5332
dedalfsermarskramer.nlDalfser MarskramerThe Dalfser Marskramer is a local news website reporting news and events from the region of Salland and surrounding municipalities.Associations → Rotary 62 News & Journalism → Regional News 948 clothing bank 38 runner 126 municipality 6837 news 15293 event 45199 Raalte → Luttenberg 532
bloklugthart.nlBlokLugthartThe website showcases a collection of public art installations and sculptures located throughout the Netherlands.Sculpture → Visual Arts 4165 public space 137 sculpture 1440 artwork 2248 installation 13742 Westerwolde → Ter Apel 345
agrarischeschouwjoure.nlWefabricThe Agrarische Schouw Joure is a Northern Trade Fair held annually in September, focused on the agricultural sector.Business & Professional → Trade Shows 951 floor plan 394 fair 583 sponsors 2642
meulen.nlVan der Meulen Edelmetaal B.V.Van der Meulen Edelmetaal B.V. is a specialist company focused on the recycling of precious metals and related services.Investing → Precious Metals 326 Waste Management → Recycling 1027 precious metal 78 trade 553 recycling 1036 analysis 1615
nyeskou.nlTheeschenkerij Nije SkouThe website of Theeschenkerij Nije Skou presents the history, current ferry service, and tea house in the area around Nije Skou, Skarsterlân.Water → Rivers 180 Water Transportation → Ferries 129 tea house 73 ferry 179 tourism 303 foundation 6678 history 7286 Friesland → Leeuwarden 6068
joure.nlVisit JoureThe Visit Joure website presents the town of Joure, Friesland, and highlights the unique atmosphere and history of the town, particularly the hospitality and relaxed ambiance stemming from its trading past.Local & Regional Focus → Local Businesses 1077 Places → Towns 380 trade 553 hospitality 3491 history 7286 event 45199
friesetuigpaard.nlVereniging Het Friese TuigpaardThe website of Vereniging Het Friese Tuigpaard provides recent news, upcoming competitions and results of events related to the Friesian Draft Horse.Equestrian → Riding Clubs 245 results 3954 competition 4759 news 15293 Opsterland → Wijnjewoude 86
nederlandsefierljepbond.nlDutch Fierljepping Association (NFB)The website serves as a central information source about fierce jumping (fierljeppen) in the Netherlands, including records, rankings, tournament overviews, and regulations. It also aims to support the Dutch Fierljepping Association (NFB).Extreme Activity → Extreme Sports 60 rankings 44 record 1098 tournament 2476 association 8562 Southwest-Friesland → IJlst 157
molkwarderkoeke.nlBakkerij Molkwar BVThe website of Molkwarder Koeke describes the family-run business that produces traditional Dutch pastries, with a focus on Friesland’s baking history and tradition.Bakery & Food Production → Artisan Bakeries 77 friesland 692 bakery 718 pastries 946 recipe 5142 Southwest-Friesland → Molkwerum 30
vvheeg.nlVoetbalvereniging HeegThe website of Voetbalvereniging Heeg provides information about the club, its history, teams, events, and activities.Sports Clubs → Local Sports Clubs 248 football club 603 sponsors 2642 youth 3126 match 3471 event 45199 De Fryske Marren → Balk 224
obsakkrum.nlOBS AkkrumOBS Akkrum is a public primary school that focuses on developing critical and creative thinking, collaboration, and problem-solving skills in children within a safe environment.Early Years → Parent Involvement 172 Arts & Culture → Social Education 33 environment 4873 school 7856 child 11566 education 13471 collaboration 16036 Heerenveen → Akkrum 246
jouwjoure.nlN.V.The website 'YourJoure' is an information and community platform for the residents of Joure, managed by residents of Joure.Initiatives & Collaboration → Initiatives 459 Blogs & Publications → Regional 272 market 2772 festival 3804 photo 7778 event 45199
oudlemmer.nlStichting Oud LemmerThe Stichting Oud Lemmer website presents photos, stories, and factual information about the history and surroundings of Lemmer, Friesland.History → Historical Events 205 News & Journalism → Regional News 948 De Fryske Marren → Balk 224
oaters.nlBV Oaters Basketbal Vereniging JoureBV Oaters Basketbal Vereniging Joure is a basketball club welcoming members of all ages and organizing matches.Team Sports → Basketball 244 Youth Development → Youth 1033 basketball club 49 match 3471 member 10154 news 15293 coach 25810
historiejoure.nlHistory Working Group JoureThe website of the History Working Group Joure serves as a repository and presentation platform for information about the history of the municipality of Skarsterlân, specifically the former municipality of Joure. The aim is to collect stories, photos, and documentation from residents and to publish them.Institutions → Historical Associations 421 Visual Arts → Museums 2049 visual material 38 documentation 452 archive 2067 history 7286 story 8285
scjoure.nlSportclub JoureSportclub Joure is an omni-sports association focused on football and korfbal, providing information and services for members and the community.Sports Associations → Dutch Sports Associations 53 Sports Activities → Football 4144 korfbal 182 football 1347 sponsorship 2686 membership 10442 news 15293 event 45199
dewerfjoure.nlWoon-zorgcomplex De WerfThe website for Woon-zorgcomplex De Werf in Joure provides information about the development of a new, sustainable living and care complex with a health center, apartments, and a community center.Apartment Living → Complexes 26 Senior & Assisted Living → Assisted Living 65 care provider 100 living 578 apartment 5088 construction 7421
keatling.nlOSCOMThe website for Keatling is an online resource providing information about the vocal group Keatling, including their history, members, repertoire, schedule, and recent performances.Theater → Performances 649 vocal group 50 guestbook 338 song 1285 repertoire 2497 schedule 2624 De Fryske Marren → Haskerhorne 14
vcjoure.nlVolleybal Vereniging VC JoureThe website of Volleybal Vereniging VC Joure presents the club, its activities, teams, events, and information for potential members and visitors.Team Sports → Volleyball 842 volleyball 617 sponsorship 2686 youth 3126 match 3471 training 28133
vtbm.nlVereniging Ter Bevordering van de MotorsportThe website of Vereniging Ter Bevordering van de Motorsport provides information and organizes grass track races in the northern provinces of the Netherlands.Motorsport → Racing 228 standings 143 race 1043 sponsors 2642 volunteer 8367 membership 10442 Het Hogeland → Wehe-den Hoorn 23
csc-joure.nlCSC JoureThe CSC Joure website is an online platform for members and potential members of the sports club, providing information on the schedule, activities, member benefits, and the possibility to order sportswear. It also serves as a place for job postings and general meetings.Sports Clubs → Gymnastics 481 Early Years → Childcare 6029 tumbling 21 sportswear 352 gymnastics 502 volleyball 617 trial lesson 1433 member 10154
knooppuntjoure.nlKnooppuntjoure.nlThe website describes the Knooppunt Joure, a junction of the A6 and A7 highways in Friesland, and the history of the construction and development of this junction.Advertising → Online Advertising 948 Civil & Infrastructure → Roads 252 junction 11 highway 88 friesland 692 history 7286 Zaanstad → Zaandam 2740
famberhorst.nlVrienden van HeremastateThis website provides information about the nature reserve ‘De Famberhorst’ in Skarsterlân, highlighting its history, location, and relationship to the nearby park Heremastate.Architecture & Sites → Historical Sites 1951 Nature → Nature Reserves 1032 nature reserve 339 's-Hertogenbosch → Empel 51
ijsbaanvanjoure.nlIJsclub De VleckeIJsbaan van Joure is an ice skating rink in Joure, Netherlands, open for skating and ice hockey, providing information about events and opening times.Skating → Ice Rinks 475 chocolate milk 17 rink 39 ice hockey 45 ice 178 skating 314 club 4225 De Fryske Marren → Sint Nicolaasga 146
kleurrijkfryskemarren.nlKleurrijk Fryske MarrenThe website of the political party KFM - Kleurrijk Fryske Marren presents their vision, positions, and the list of council members.Local Politics → Political Parties 898 Local Politics → Municipal Council 484 council member 107 position 875 trust 1147 resident 3245 municipality 6837 De Fryske Marren → Lemmer 1188
kvdeoorsprong.nlKV de OorsprongKV de Oorsprong is the kaats (shuttlecock) club of St-Nicolaasga and Joure, and the website provides information about the association, its activities, and board changes.Municipalities → Governance 1043 Higher Education → Business Schools 11 meeting 2381 board 3438 member 10154 De Fryske Marren → Sint Nicolaasga 146
ruterwille-jongutein.nlLR Ruterwille & PC Jong ut einLR Ruterwille & PC Jong ut ein is a club that organizes lessons, activities, and competitions for members of all ages.Livestock → Cattle 30 Team → Billiards 365 minutes 169 stables 212 facility 2616 club 4225 competition 4759 lesson 5154
styleconsulting.nlStyle ConsultingThe website of Style Consulting offers color and figure analysis, personal styling advice, and wardrobe planning services, aiming to help clients discover their unique style and make a positive first impression.Personal Development → Self-Help 1791 Fashion → Style Advice 370 styling advice 96 color analysis 112 wardrobe 355 color 4159
mooiblik.nlmooiblikThe website mooiblik.nl offers nostalgic advertising signs for various purposes, including home, garden, kitchen, and commercial spaces such as restaurants and cafes. The website also offers signs for special occasions like birthdays and father's day.Decoration → Wall Decoration 40 Local Events → Markets 1097 sign 126 decoration 4085 brand 17737 event 45199 De Fryske Marren → Oudemirdum 73
rufus.nlRufus aan het waterThe website of Rufus aan het water presents a recreational area in Friesland that offers accommodation, boating and stays in harbors, campsites and recreational houses, with an emphasis on nature, relaxation and water-based activities.House Types → Houses 2546 Boating → Harbors 252 sloop 272 harbor 691 camp 2466 terrace 4847 De Fryske Marren → Goingarijp 86
henx.nlHenk Veenstra FotografieThis website showcases the work of freelance photographer Henk Veenstra, featuring portraits and a variety of photographic projects.Nature & Landscape → Landscape Photography 530 Context 161394 industry 1780 city 1875 portrait 3685 photo 7778 event 45199 Eemsdelta → Woldendorp 21
bakkervakkeuken.nlBakker VakkeukenBakker Vakkeuken is a specialist in kitchen technology and refrigeration technology for professional kitchens.Hospitality → Kitchen Equipment 315 Energy & Sustainability → Refrigeration 211 refrigeration technology 34 skilled workers 68 customization 1723 Northeast-Friesland → Dokkum 846
waterparkterherne.nlWaterpark TerherneWaterpark Terherne offers boat rentals and holiday homes in a prime location on the Sneekermeer in Friesland.Water → Lakes 232 Water Sports → Water Recreation 599 sneekermeer 14 boat rental 124 motorboat 128 sailboat 148 holiday home 2753 Leeuwarden → Warten 81
jachtwerfdejong.nlJachtwerf de Jong JoureThe website of Jachtwerf de Jong Joure showcases a range of wooden boats, including dinghies, sloops, and classic models, offering services focused on new construction, maintenance, restoration, and sales.Maritime → Shipbuilding 568 Water → Boats 935 dinghy 13 teak 103 sloop 272 restoration 3417 model 3546 paint 8747
in-zicht.nlStichting In-zichtStichting In-zicht is an organization focused on promoting awareness and supporting a world of harmony, unity, and abundance.Spirituality → Consciousness 193 awareness 1735 newsletter 6504 nature 9094 event 45199
mobieleklimwand.nlMobile Climbing WallThe website presents a mobile climbing wall that can be rented for various events and occasions, such as street parties, sporting events, and festivals.Children’s Activities → Playgrounds 702 Sport Facility → Climbing 202 climbing wall 12 climbing 139 instructor 3126 event 45199 Deventer → Schalkhaar 138
plantingjoure.nlPlanting Stalen MeubelenPlanting Stalen Meubelen is a manufacturer of steel frames for furniture.Tables → Dining Tables 154 sofa 481 frame 883 chair 1223 table 1778 transport 6105
ballonfeesten.nlStichting Friese BallonfeestenThe website for the Friesian Balloon Festival in Joure provides information about the annual balloon event, including the current program, the option to book balloon flights, and ways to support the festival.Festivals → Music Festivals 1020 Adventure → Hot Air Ballooning 93 balloon 554 festival 3804 donation 5110
makelaardijhoekstra.nlMakelaardij HoekstraMakelaardij Hoekstra is a real estate brokerage based in various locations in Friesland that offers services for both the sale and purchase of homes and commercial properties, as well as real estate management and appraisals.Automotive → Sales 1205 real estate brokerage 55 real estate management 123 commercial property 469 appraisal 1488 new construction 2672 home 7976 Southwest-Friesland → Sneek 1921
zadenbibliotheeknederland.nlZadenbibliotheek NederlandThe website Zadenbibliotheek Nederland provides information and access to a network of volunteer seed libraries across the Netherlands, where visitors can borrow, exchange, and donate seeds.Social Issues → Social Organization 13315 Gardening → Seeds 319 gardening 505 seed 599 library 988 collection 7566 volunteer 8367
tolhuisjoure.nlHet Tolhuis JoureThe Tolhuis Joure is a restaurant, bar, and Grand Café in Joure offering various services including meals, drinks, catering, and accommodation.Cafes → Grand Cafés 228 Cafes → Brown Cafés 599 grand café 95 bar 1216 catering 6456 restaurant 11215 menu 13856 event 45199
dejongensvanjoure.nlDe Jongens van JoureThe Jongens van Joure is a restaurant and grand café located in Joure that serves traditional and modern dishes and organizes events.Places → Towns 380 Team → Billiards 365 fish 1121 space 3846 wine 4476 restaurant 11215 menu 13856 event 45199
dejoustertoer.nlThe JoustertoerThe Joustertoer website provides information about the restaurant and a new culinary location in Joure.Architecture & Sites → Historical Sites 1951 Bars & Pubs → Gastropubs 57 culinary 199 gift voucher 548 hospitality 3491 restaurant 11215 event 45199
2wielercentrumjoure.nl2Wielercentrum JoureThe website of 2Wielercentrum Joure is a bicycle shop in Joure that sells new and used bicycles, repairs bicycles, and offers bicycle rentals.Repair → Bicycle Repair 405 Cycling → Bicycle Sales 455 bicycle shop 99 cargo bike 278 bicycle 2838 coffee 3838 rental 7257 repair 14576
marcoseetcafe.nlMarco's EetcaféMarco's Eetcafé is a cafe and eatery in Joure offering catering, takeaway menus, and a terrace.Venues → Event Spaces 432 Quick Bites → Snack Bar 580 snack bar 162 cafe 1622 coffee 3838 terrace 4847 catering 6456
stokertje.nl't StokertjeThe website 't Stokertje offers a wide range of fireplaces and stoves, including advice, installation, and maintenance.Heating → Stoves 301 Heating → Fireplaces 578 stove 305 fireplace 752 assortment 7799 installation 13742 brand 17737 maintenance 20093 Midden-Drenthe → Orvelte 54
cadvb.nlCADVBThe website of CADVB offers services in the field of BIM (Building Information Modeling) and technical building consulting, with a focus on supporting companies with the implementation of BIM processes.Architecture → BIM 53 Architecture & Design → Building Consulting 314 architectural drawings 27 3d modeling 67 bim 307 consulting 3639 Noordoostpolder → Emmeloord 1649
laptopleasing.nlLaptopleasing.nlLaptopLeasing provides MKB (SME) businesses with lease packages for complete laptop and desktop workstations, including installation and service, aiming to offer flexible and professional IT solutions.Technology → IT 3337 Electronics & Components → Computer 4084 hardware 941 laptop 1320 installation 13742 South-Holland → The Hague 19898
spitfire.nlTriumph Spitfire ClubThe website of the Triumph Spitfire Club aims to preserve and keep the Triumph Spitfire and GT6 vehicles running.Cars → Classic Cars 1145 Maintenance & Services → Automotive Clubs 153 rally 286 forum 1362 membership 10442 Apeldoorn → Loenen 220
vaarhuis.nlVaarHuis Groep B.V.The website Huisboothuren.nl offers the opportunity to rent houseboats in Friesland, with locations on the Frisian lakes and information on arrangements, routes, and local attractions.Hotels → Alternative Accommodation 27 Travel Guides → Regional Travel Guides 85 houseboat 130 friesland 692 arrangement 3104 Heerenveen → Akkrum 246
wonenindefryskemarren.nlMunicipality of De Fryske MarrenThe website of De Fryske Marren – Kavel presents various building plots for sale in the De Fryske Marren project area, providing information on available plots, prices, and project-based options.Land → Building Plots 49 Context 161394 building plot 80 block 91 municipality 6837 price 8328 De Fryske Marren → Balk 224
snowsportsjoure.nlSnowsports JoureSnowsports Joure is a ski school that offers winter sports enthusiasts, from beginners to experienced skiers, a safe and enjoyable way to learn and practice, both indoors and in preparation for the real snow.Winter Sports → Snowboarding 179 ski 256 snowboard 352 instructor 3126 lesson 5154 shop 6483
watervriend.nlJachthaven De WatervriendThe website of Jachthaven De Watervriend in Uitwellingerga presents the marina as an attractive and central mooring location in Friesland, with options for accommodation, rental, and activities.Boating → Marinas 825 Accommodation → Lodging 317 berth 341 marina 487 accommodation 4921 rental 7257 Southwest-Friesland → Sneek 1921
bistrofredjoure.nlBistro Fred and JoureThe website of Bistro Fred and Joure is an online presentation of a bistro in Joure, offering a wide range of dishes and drinks in a cozy ambiance and providing options for takeaway, reservations, and location information.Water → Boating 1592 Brasseries & Bistros → Bistro 594 bistro 219 reservation 3373 terrace 4847 dish 5936 menu 13856
ambion.nlAmbionThe website of Ambion describes a group of 22 public primary schools in the Joure and Heerenveen region, offering quality education with a focus on trust, connection, and development, particularly emphasizing innovation and the implementation of the Apple learning environment.Primary Education → Public Education 424 course plan 10 innovation 4659 school 7856 education 13471 Friesland → Heerenveen 2578
luchtverwarmingshop.nlEconvice NederlandLuchtverwamingshop.nl is a webshop that sells and arranges the replacement of air heaters.Installation & Repair → Ventilation 859 part 5044 webshop 8648
kokogo-ballonvaart.nlKoKoGo Balloon RidesThe website of KoKoGo Balloon Rides offers opportunities to book hot air balloon trips throughout the Netherlands, with a focus on a complete adventure and a guarantee against bad weather.Adventure → Hot Air Ballooning 93 hot air balloon ride 14 hot air balloon 36 pilot 208 gift certificate 646 Maasgouw → Thorn 120
hoteljoure.nlBoutique Hotel JoureThe website aims to promote Boutique Hotel Joure, a hotel in Joure, Friesland, and to offer boat rentals, providing information and booking options for guests.Hotels → Boutique Hotels 914 Accommodation → Breakfast 364 living room 1325 breakfast 1822 parking 1928 boat 2980 room 3411 hotel 3543
stienstrajoure.nlTegels & Sanitair StienstraTegels & Sanitair Stienstra is a specialist in Friesland that helps customers with the design and selection of bathrooms, tiles, and sanitary ware.Kitchen → Floor Tiles 130 Bathroom → Sanitary Ware 845 sanitary ware 669 tile 2869 bathroom 3784 showroom 4883 design 27202
rondvaardij-princenhof.nlRondvaardij PrincenhofRondvaardij Princenhof provides luxury party boats and arrangements for various events.Water Travel → Boat Tours 640 Conferences & Meetings → Meetings 295 tours 1048 buffet 1747 boat 2980 arrangement 3104 event 45199 Leeuwarden → Grou 366
cafedestam-joure.nlCafé de StamCafé de Stam is a meeting place in Joure offering a variety of activities and entertainment.Community & Social → Pub Quizzes 195 Neighborhood Focus → Community Centers 941 bingo 130 darts 307 billiard 341 cafe 1622 terrace 4847 performance 7586
8501indie.nlStichting 8501indieThe Stichting 8501indie website promotes and fosters pop music and pop culture in Joure and the surrounding area.Live Music → Cover Bands 433 Performance → Pop Music 412 band 2977 video 6714 music 13170
groencentrumwitmarsum.nlGroencentrum WitmarsumGroencentrum Witmarsum is a garden center located in Friesland, offering a wide range of garden plants, flowers, accessories, and catering options, as well as gift cards.Plants → Garden Plants 220 garden plants 66 vegetable garden 226 gift card 582 flowers 3248 restaurant 11215 accessories 12975 Southwest-Friesland → Sneek 1921
veenstra-joure.nlVeenstra Bedrijfsauto's Joure BVThe website of Veenstra Bedrijfsauto's Joure BV presents a current offer of new and used commercial vehicles and passenger cars, with a focus on the Joure region.Car Selling & Valuation → Passenger Cars 992 Automotive → Commercial Vehicles & Trucks 1981 car sale 61 commercial vehicle 326 showroom 4883
dusonederland.nlDuso Nederland B.V.The website of Duso Nederland offers industrial vacuum cleaners, central extraction systems, and related equipment and services for various industries.Machinery & Repair → Machinery 1045 Maintenance & Repair → Industrial Maintenance 732 atex 35 vacuum cleaners 78 industry 1780 accessories 12975
overnachtenfriesland.nlCamping ‘Lyts mar Smûk’”The website of Camping ‘Lyts mar Smûk’ presents a peaceful campsite in Friesland, offering facilities, rental options, activities, and the possibility of staying in a B&B. The aim is to inform potential guests about the campsite and the surrounding area.Camping → Minicamping 246 Camping → Camper Sites 243 friesland 692 sanitary 750 b&b 1060 cycle 1906 campsite 2093 De Fryske Marren → Goingarijp 86
internet-marketing-friesland.nlInternet Marketing FrieslandInternet Marketing Friesland is a company offering internet marketing services primarily in the Friesland region.Online Marketing → Affiliate Marketing 299 Business → Industry 36977 internetmarketing 71 google 192 cms 613 campaign 3428 blog 13392 De Fryske Marren → Balk 224
turfskip.nlWatersportbedrijf TurfskipWatersportbedrijf Turfskip offers motorboat rentals in Friesland and surrounding areas, featuring various sailing areas and boat models.Boating → Marinas 825 Sailing → Sailing Schools 70 sailing course 16 sailing area 28 motorboat 128 vacation 4234 De Fryske Marren → Balk 224
koopzondageninfo.nlKoopzondaginfo.nlThe website provides an overview of shopping Sundays and shopping evenings in the Netherlands, including opening hours and tips.Commerce → Shopping Centers 1001 shopping sunday 22 province 518 opening hours 2953 relaxation 3968 shop 6483 home 7976 Oldambt → Winschoten 830
ovs-skarsterlan.nlOndernemersvereniging SkarsterlânThe OVS is an entrepreneur’s association focused on promoting mutual trade and representing the interests of its members to the municipality.Investing → Cryptocurrency 776 Associations & Groups → Business Associations 1018 trade 553 interest 911 municipality 6837 member 10154 event 45199 De Fryske Marren → Sint Nicolaasga 146
arbeidsmakelaar.nlArbeidsmakelaarsArbeidsmakelaars is a matching agency that helps job seekers and employers find the right fit.Staffing & Recruitment → Technical Staffing 395 Employment & Labor → Employers 608 agency 944 employer 2383 job 2795 match 3471 vacancy 6598 Venlo → Tegelen 324
wal-sloopwerken.nlVan der Wal Sloopwerken, Asbestsanering and RecyclingThe website of Van der Wal Sloopwerken, Asbestsanering and Recycling presents the company as a specialist in sustainable demolition, asbestos removal and recycling in Northern Netherlands, with a tradition of over 50 years.Environmental Technology → Asbestos Remediation 191 Building & Materials → Demolition 687 asbestos removal 134 recycling 1036 demolition 1144 certification 3380 Noordoostpolder → Emmeloord 1649
handiginhout.nlHandig in HoutThe website of Handig in Hout in Joure offers custom interior construction and kitchen solutions.Kitchen → Custom Furniture 473 Kitchen → Kitchen Solutions 24 cabinet 1730 wood 4153 kitchen 6443 interior 8093 furniture 8751 design 27202
hayobol.nlPraktijk Hayo BolThe website of Praktijk Hayo Bol presents itself as a naturopathic practice located in Joure and Amsterdam, specializing in diagnosing and treating various ailments using diverse complementary therapies.Alternative Medicine → Naturopathy 1097 Complaints & Symptoms → Symptoms 20 bioreasonance 44 orthomolecular medicine 62 test 769 scan 790 therapy 7448 North-Holland → Amsterdam 41253
outdoorliving.nlWellness & OutdoorlivingThe website of Wellness & Outdoorliving in Joure offers a wide range of wellness products, including Jacuzzi® SunSpas, saunas, and swim spas, and is the largest wellness showroom in Northern Netherlands.Services → Hot Tubs 126 Spa → Saunas 920 swim spa 30 spa 355 sauna 1175 showroom 4883 accessories 12975
zltenergie.nlZL T EnergyThe website of ZLT Energie is a specialist in solar energy, helping customers save energy and offer smart home solutions, including solar panels, home batteries, and an energy manager.Solar Energy → Storage Solutions 37 Energy → Energy Management 504 energy management 144 home battery 517 solar panels 4701
juweliersvergelijken.nlEdelsmid Rob KoenraadsThe website provides an overview of jewelers in the Netherlands, including location data and opening hours.Accessories → Jewelry 3517 Shops → Watches 655 jeweler 70 diamond 198 wedding rings 281 watch 1166 advertisement 1707 jewelry 4599 Heeze-Leende → Heeze 463
zonmaat.nlZonmaatZonmaat is a specialist in installing solar panel systems for social housing, aiming to make sustainable energy accessible to everyone.Heating → CV Installation 134 Technical Services → Technical 957 solar panel system 10 solar energy 373 housing corporation 424 technician 815 installation 13742 Albrandswaard → Poortugaal 206
ijbgroep.nlIJB GroepThe website of IJB Groep presents a complete solution for foundation work, with a focus on sustainable and circular solutions.Construction Technology → Foundation Technology 135 pile 39 prefabricated 69 soil investigation 80 foundation 6678 construction 7421 sustainability 18451 Overijssel → Kampen 2161
fytt.nlFYTT Fysiotherapie HeerenveenThe website of FYTT Fysiotherapie Heerenveen offers physiotherapy, manual therapy, sports physiotherapy, and edema therapy, with a focus on personalized care and treating a variety of complaints. The goal is to promote a healthy lifestyle and treat physical ailments.Physiotherapy → Sports Physiotherapy 747 Physiotherapy → Specialized Physiotherapy 74 edema therapy 186 sports physiotherapy 436 manual therapy 1320 physiotherapy 4688 complaint 6479 appointment 13510 Friesland → Heerenveen 2578
frieslandontruimingen.nlFriesland DemolitionThe website offers services for home and business clearance (demolition).Family → Funeral Services 2084 clearance 349 commercial property 469 cleaning 4567 home 7976 quote 12863 Achtkarspelen → Surhuisterveen 281
online-marketing-friesland.nlTjeerd EngelThe Online Marketing Friesland website by Tjeerd Engel provides online marketing services in the Friesland region.Advertising → Online Advertising 948 advertisement 1707 seo 3707 marketing 7107 strategy 9379 De Fryske Marren → Balk 224
mateboer.nlMateboerThe website of Mateboer describes a family-owned company specializing in construction, project development, and environmental technology, with a focus on sustainability and a positive work environment.Building & Construction → Sustainable Building 1004 Real Estate → Project Development 633 environmental technology 27 housing development 130 project development 215 employee 4429 construction 7421 sustainability 18451 Overijssel → Kampen 2161
vakantiekriebelsenvrijetijd.nlMedisch Pedicure Joure 40 VoetThe website of Medisch Pedicure Joure 40 Voet presents the services of a certified medical podiatrist, Gerrie Gerritsma, who cares for feet, particularly with conditions such as rheumatism, diabetes, and other foot problems, both in the practice and remotely.Foot Care → Medical Foot Care 710 Chronic Diseases → Diabetes 349 rheumatism 219 podiatrist 326 diabetes 750 sail 965 nails 1719 foot 1929
desaunaspecialist.nlDe SaunaspecialistThe website of De Saunaspecialist presents and sells custom-made saunas, infrared cabins, and steam cabins, as well as related accessories and services.Garden → Swimming Pools 601 Spa → Saunas 920 infrared 89 steam 147 oven 324 sauna 1175 accessories 12975
dietisthestervisser.nlDiëtistenpraktijk Hester VisserThe website of Diëtistenpraktijk Hester Visser presents the services of a dietetics practice, focused on nutritional advice and dietetics, with special attention to children and sports nutrition. It also offers an online support option and information about the practice locations and the client portal.Nutrition → Dietetics 816 client portal 30 dietitian 299 nutritional advice 317 practice 9089 De Fryske Marren → Oudehaske 49
datstaatmeubelverhuur.nlDat Staat MeubelverhuurThe website ‘Dat Staat Meubelverhuur’ offers furniture rental services for various purposes, including sales styling, furnishing holiday homes, and projects, catering to both private and business clients.Logistics & Transportation → Rental Companies 414 furnishing 292 rental 7257 furniture 8751 quote 12863 North-Brabant → Deurne 1329
fysio-actief.nlFysio-ActiefThe website of Fysiotherapie Fysio-Actief offers physiotherapy treatments and fitness options in Sneek, Bolsward and Joure, with a focus on recovery and an active lifestyle.Sports → General Sports 92 fitness 2251 lifestyle 2918 sport 4228 physiotherapy 4688 complaint 6479 treatment 21203 Southwest-Friesland → Sneek 1921
corverkammen.nlCorverkammenThe website offers services related to selling cars, including scrap cars and damaged cars.International Trade → Export 674 Driving & Lessons → Vehicles 541 damage car 38 auto 67 scrap car 127 pickup service 172 rdw 263 quote 12863 Drimmelen → Made 335
pizzeriasardegna.nlPizzeria-Ristorante SardegnaThe website of Pizzeria-Ristorante Sardegna is an online platform for viewing the menu, booking a table, and ordering gift certificates, as well as providing information about the restaurant and contact details.Ice Cream → Ice Cream Parlors 521 pizzeria 76 gift certificate 646 family business 793 reservation 3373 foundation 6678 menu 13856
frieslandautovoordeel.nlFriesland AutovoordeelFriesland Autovoordeel is an auto dealership specializing in used cars and offering them at attractive prices with delivery packages.Finance → Loans & Credit 1979 delivery package 10 occasion 2036 price 8328 car 10865 brand 17737
gewichtsbeheersingvanatotz.nlGewichtsbeheersing van A tot ZGewichtsbeheersing van A tot Z is a webshop and coaching program providing personalized guidance to help users adopt a healthier lifestyle and lose weight.Diets → Low-Carb 26 Physical Fitness & Exercise → Weight Loss 1147 diet 747 nutrition 4935 goal 4974 coach 25810 Southwest-Friesland → Koudum 134
verhuizenoverzicht.nlVerhuizenOverzicht.nlThe website, verhuizenoverzicht.nl, provides an overview of moving companies in various regions of the Netherlands.Moving → Movers 272 Moving → Moving Companies 835 moving company 178 region 5412 quote 12863 Zwartewaterland → Genemuiden 405
inuz.nlInuzInuz is a women's fashion boutique located in Friesland, Netherlands, offering clothing, shoes, and accessories both in physical stores and online.Clothing → Men’s Clothing 1008 Context 161394 shoes 2699 clothing 9443 accessories 12975 brand 17737 Achtkarspelen → Surhuisterveen 281
electroboer.nlFA. GEBR. DE BOERThe website of FA. GEBR. DE BOER is an information platform that presents the services and projects of the company in the areas of electrical engineering, installation technology, and sustainable energy.Installation & Repair → General Installation 727 network cabling 15 sustainable 739 electricity 745 heat 2188 installation 13742
8baan.nl8baan.nlThe website 8baan.nl collects and presents job vacancies offered by municipalities.Employment & Labor → Labor 504 role 234 hr 884 administration 6587 vacancy 6598 municipality 6837 Leeuwarden → Grou 366
bureaudrugszaken.nlBureau DrugszakenBureau Drugszaken provides training programs and expertise to police, fire departments, municipalities, and housing associations, focused on recognizing and combating drug-related issues.Adult & Continuing Learning → Professional Training 1224 Government & Administration → Law Enforcement 55 drugs 105 police 480 municipality 6837 education 13471 training 28133
joustermerkeloop.nlAV HeerenveenThe website describes the Joustermerkeloop, an annual running race that takes place in Joure, Netherlands, and which will take place on the fourth Sunday of September.Walking → Walking Events 137 Running → Running Events 684 distance 270 race 1043 sponsors 2642 route 3425 volunteer 8367
frieschen.nlFrieschen BeddenFrieschen Bedden offers bespoke boxsprings, waterbeds and mattresses, focusing on modular design and ergonomic support.Beds → Boxsprings 229 Crafts → Traditional Crafts 37 waterbed 53 ergonomic 88 modular 160 boxspring 282 mattress 899 comfort 1473
werktijdbv.nlWerktijd BVThe website of Uitzendbureau Werktijd is a platform that offers job vacancies and provides staffing services in Northern Netherlands.Employment & Labor → Labor Market 580 Education → Career & Guidance 1157 labor market 296 friesland 692 staff 3405 employee 4429 vacancy 6598 Achtkarspelen → Buitenpost 215
zaalverhuur-overzicht.nlZaalverhuurgidsThe website is an online directory for finding event venues in the Netherlands.Brasseries & Bistros → Brasserie 1005 Event Planning → Venue Rental 63 venue 879 reviews 3172 event 45199 Westerkwartier → Zuidhorn 286
robertberger.nlRobert BergerThis website presents Robert Berger, a musician, pianist, and entertainer, providing information about his career, schedule, and unusual performances.Classical Music → Pianists 83 Popular → Rock 942 africa 150 pianist 291 piano 820 band 2977 concert 4409 performance 7586 South-Holland → The Hague 19898
pophop.nlPopHop Dutch Craft BeerThe website of POPHOP Dutch Craft Beer presents a selection of craft beers in combination with music, emphasizing the pairing of beer and music.Music → Genres 1752 Beverages → Beer 1095 packs 56 playlist 231 beer 2887 shop 6483 music 13170 Lingewaard → Bemmel 509
balloncentrum.nlNorthern Hot Air Balloon CenterThe Northern Hot Air Balloon Center is a company that offers professional hot air balloon rides in the north and provides the opportunity to buy tickets, schedule flights, and find information about hot air ballooning.Adventure → Hot Air Ballooning 93 hot air balloon 36 opportunity 581 flight 864 ticket 2785 price 8328 Leeuwarden → Grou 366
administratiekantoren-nederland.nlAdministratiekantoorgids B.V.The website provides an overview of accounting firms and bookkeeping offices in the Netherlands, offering location information, reviews, opening hours, and business registration opportunities.Finance → Taxation 1567 accounting firm 250 benefits 369 reviews 3172 Sittard-Geleen → Sittard 1997
passantenhaven-joure.nlDe Grienedyk BVThe Grienedyk Marina and Camping Joure is a marina and campsite in Friesland that welcomes passengers and campers.Boating → Marinas 825 Water Sports → Water Recreation 599 webcam 236 marina 487 camp 2466 space 3846
airco-point.nlAirco-point.nlAirco-point.nl is an online shop specializing in the sale of climate products, including mobile air conditioners, air coolers, and fans.Climate Control → Air Conditioning 1022 fan 298 air conditioner 408 newsletter 6504 assortment 7799
zonderland-machinehandel.nlZonderland Machinehandel BVThe website of Zonderland Machinehandel BV showcases agricultural machines from the Zocon brand and provides information on the distribution of these machines in the BeNeLux region.Jobs → Vacancies 1099 Machinery & Repair → Machinery 1045 agriculture 778 catalog 812 work 3122 machine 3727 safety 5819
puurmondzorg.nlPUUR MondzorgPUUR Mondzorg is a group of dental practices in Northern Netherlands that offers a personalized care program and provides specialized services to promote the health of its patients.Dentistry → Specialties 378 Health → Medical Care & Services 29461 dental practices 14 care program 36 oral health 686 patient 4082 care 12338 treatment 21203 Northeast-Friesland → Dokkum 846
kraammarkt.nlKraamMarktKraamMarkt is a platform that facilitates the employment of ZZP (self-employed) childcare providers and offers various services focused on optimizing their administrative and financial processes.Prevention → Contraception 92 International → International Business Services 51 placement 221 invoice 795 administration 6587 care 12338
vandeurzen-incasso.nlVan Deurzen Incasso Bedrijf & AdviesVan Deurzen Incasso Bedrijf & Advies provides business recovery and advisory services focused on improving customer payment behavior and optimizing credit management processes.Financial Management → Credit Management 46 Legal → Debt Collection 554 credit management 56 invoice 795 Berkelland → Borculo 347
friesesloep.nlBootox SloepverhuurBootox Sloepverhuur offers luxurious boat rentals and tours on the Frisian waters, catering to parties, outings, and events.Water Travel → Boat Tours 640 Corporate Events → Corporate Outings 878 boat trip 184 cruise 405 outing 982 boat 2980 event 45199 Southwest-Friesland → Sneek 1921
inzetonline.nlInzet OnlineThe website of Inzet Online offers digital marketing services focused on driving business growth for its clients.Online Marketing → Google Ads 492 Marketing & Advertising → Strategy Consulting 37 revenue 693 results 3954 Westerkwartier → Opende 86
sellacq-holland.nlSELLACQ Holland B.V.Sellacq Holland is a company specializing in the supply of candle making supplies, wax products for the horticultural industry, and expert advice on paraffin and related products.Crafts → Candle Making 67 Agriculture → Horticulture & Floristry 1404 wax 711 candle 792 supply 961
tegelzetter.nlTegelzetter.nlThe website of Marco Nijholt tile company presents its services as a specialist in tile laying, especially Marazzi, and provides project examples and contact information.Renovation → Tiling 397 Finishing & Trades → Tile Installers 56 tile 2869 studio 5465
zingendverbonden.nlChristelijk mannenkoor Zingend VerbondenThe website of the Christian men’s choir ‘Zingend Verbonden’ presents information about the choir members, agenda, and history of the choir, which was formed in 2020 through a merger of two male choirs.Choir → Men’s Choir 212 Religious Organizations → Protestant Organizations 114 merger 323 repertoire 2497 choir 3123 performance 7586 member 10154 Friesland → Heerenveen 2578
cecilia-catharina.nlCecilia CatharinaThe website of Cecilia Catharina Bed & Breakfast presents a charming stelpboerderij in Joure, Friesland, as a unique location for a vacation, focusing on peace, nature, and a glimpse into a dairy farm.Accommodation → Country Estates 738 Nature → Estates 771 dairy cows 23 grassland 71 bed and breakfast 305 accommodation 4921 nature 9094
nationaleherdenkingjoure.nlStichting Nationale Herdenking JoureThe Stichting Nationale Herdenking Joure is dedicated to preserving memories of World War II and promoting awareness of the consequences of war.World War II → Battle of Arnhem 11 World War II → Remembrance 120 remembrance 165 war 272 monument 1168 history 7286 story 8285 education 13471
meiwurkje.nlMeiwurkje UitzendburoMeiwurkje Uitzendburo is an employment agency located in Joure, Heerenveen, and Lemmer, providing work and jobs throughout North Netherlands.Employment & Labor → Employers 608 Staffing & Recruitment → Temporary Staffing 1003 employment agency 78 temporary assignment 90 jobseeker 300 employer 2383 job 2795 vacancy 6598 De Fryske Marren → Lemmer 1188
lekkerbros.nlLekker BrosLekker Bros is a chocolatier and bakery that produces handcrafted chocolate and pastries using high-quality ingredients.Chocolate → Chocolatiers 96 chocolate 911 pastries 946 ingredients 2346 workshop 19325
theonebridal.nlThe One BridalThe website of ‘Bruidsmode Leeuwarden | The One Bridal’ offers a comprehensive selection of bridal wear and accessories for brides and grooms, with a focus on personalized service and inspiration for the wedding day.Weddings → Wedding Dresses 266 Context 161394 bridal wear 27 wedding suit 59 wedding dresses 98 inspiration 4081 accessories 12975 Northeast-Friesland → Dokkum 846
mntstoker.nlMNT STOKERThe website of MNT STOKER presents audiovisual technology services for various corporate events, both physical and online.Electronics & Components → Audio 2351 Audiovisual & Media → Audiovisual Services 164 audiovisual technology 11 projection 59 stream 684 technician 815 presentation 1785 event 45199 North-Holland → Diemen 975
autojoureexport.nlAuto Joure Export XL bvAuto Export XL is a RDW-recognized company specializing in the export of cars for businesses and individuals.Road Services → Automotive 18764 Freight & Logistics → International Transportation 576 declaration 112 export 630 procedure 750 license 1288 car 10865
kbo-fryslan.nlKBO FryslânKBO Fryslân is a volunteer organization dedicated to advocating for seniors in Friesland and organizing activities for its members.Social Organization → Senior Organizations 750 Social Services → Welfare 1001 branch 268 seniors 904 interest 911 volunteer 8367 Southwest-Friesland → Sneek 1921
sybox.nlSyboxSybox is a self-storage company located in Joure offering various storage solutions for businesses and individuals.Logistics → Storage 1170 shipping container 15 move 1441 box 1982 storage 2446 rental 7257
velojoure.nlStichting Vélo JoureThe website of Stichting Vélo Joure describes and organizes the annual 16 Dorpentocht, a cycling event that raises money for the Villa Joep foundation.Walking → Walking Competitions 182 Walking → Walking Events 137 participant 1934 sponsors 2642 route 3425 foundation 6678 volunteer 8367
helpinghands.nlHelping HandsHelping Hands provides personalized home care services and support in Northern Netherlands, focusing on individual needs and tailored solutions.Social Services → WMO 162 Special Needs & Support → Support 2006 family support 23 household assistance 90 indication 164 situation 655 care 12338 Noordenveld → Roden 621
zelfmanegement.nlStichting Zelf Manege-mentThe website of Stichting Zelf Manege-ment provides a social meeting place and guidance for people with physical disabilities, focusing on independence and personal development.Social Services → Welfare 1001 meeting place 76 disability 594 goal 4974 coach 25810
mini-koelkasten.nlMini-koelkasten.nlMini-koelkasten.nl is an online store that sells small refrigerators, mini wine coolers, small freezers and coolers, as well as parts and accessories from various brands.Household Appliances → Refrigerators 149 payment service 16 refrigerator 475 quote 12863 brand 17737
deijsfabriekjoure.nlDe ijsfabriek & chocoladeThe website of De ijsfabriek & chocolade in Joure presents their ice cream and chocolate assortment, offers online ordering, and describes the location and contact information.Chocolate & Sweets → Ice Cream 774 chocolate 911 ice cream 1000 shop 6483
camperplaatspontdyk.nlCamperplaats PontdykCamperplaats Pontdyk is a camper site located in Boornzwaag, Friesland, offering visitors the opportunity to stay and enjoy the surrounding area.Camping → Camper Sites 243 Camping → Campsites Netherlands 792 frisian lakes 14 pier 58 camper site 126 friesland 692 bag 2399 De Fryske Marren → Boornzwaag 17
a7.nlA7 MakelaarsA7 Makelaars is a real estate brokerage firm offering various services related to housing.Property Valuation & Appraisal → Residential Appraisal 622 Property Advice & Guidance → Real Estate Advice 135 listings 525 assessment 1205 real estate 4981 house 8121 De Fryske Marren → Boornzwaag 17
speelbosjoure.nlSpeelbos JoureSpeelbos Joure is a play location in Joure that offers various activities for children aged 1 to 12 years, including indoor play equipment, a laser game arena, and a kids escape room.Family Fun → Children’s Activities 1906 Family Fun → Family Activities 1493 laser game 142 escape room 430 playground 1088 wifi 1372 catering 6456
jous.nlJOUS architectenJOUS architecten is an independent architecture firm specializing in the design and construction of various buildings, from private homes to complex architectural projects.Urban Planning → Urban Design 235 buildings 898 architecture 3223 construction 7421 design 27202 Voorst → Twello 469
wierdabedrijfswagens.nlWierda BedrijfswagensThe website of Wierda Bedrijfswagens presents the company as the MAN dealer for Friesland, with a long tradition (since 1931) and a comprehensive range of new and used MAN trucks and vans, including electric models and associated services.Financing → Leasing 1065 Freight & Logistics → Trucks 899 electric 269 man 453 truck 1412 vehicle 3743 maintenance 20093 Smallingerland → Drachten 2052
statenenstinzen.nlStichting Staten en StinzenThe Stichting Staten en Stinzen is an organization focused on preserving and making accessible historical castles, country estates, and land estates in Friesland, particularly the states and stinzen from the Middle Ages.Cultural Attractions → Castles 178 country estate 25 state 44 route 3425 exhibition 5332 event 45199 Breda → Princenhage 63
detijnjehoeve.nlDe TijnjehoeveDe Tijnjehoeve is a charming, small camping and accommodation located in Friesland, offering glamping tents, a cottage, and a marina.Accommodation → Cabins 231 Nature → Nature Reserves 1032 glamping tent 18 group accommodation 260 cottage 299 marina 487 friesland 692 camp 2466 Southwest-Friesland → Sneek 1921
heremaparklive.nlBSS SolutionsThe website of Herema Park Live provides information about the annual music festival held in Park Heremastate in Joure.Festivals → Music Festivals 1020 foodtrucks 182 park 1863 festival 3804 child 11566 music 13170
jousterklokkenmakerij.nlJouster KlokkenmakerijThe Jouster Klokkenmakerij website is a business specializing in the restoration, repair, and sale of clocks, with a focus on traditional Frisian clocks and antique clocks from various European origins.Repair → Watch Repair 73 Crafts → Clockmaking 51 clockmaker 24 clocks 178 restoration 3417
de-koaipleats.nlKleefstra FamilyThe website of Camping De Koaipleats presents a farm camp in Terherne, located in the water-rich area of Terhorne, offering the opportunity to camp, rent a luxury chalet, and participate in activities in the region.Accommodation → Bungalow Parks 931 Nature → National Parks 898 marina 487 farmhouse 878 chalet 1264 campsite 2093 Heerenveen → Akkrum 246
fotografiebywilma.nlFotografie By WilmaThe website Fotografie By Wilma offers professional photography services, specializing in family photos, dog photography, iris photography, and attendance at local events in Friesland. The site provides an overview of photoshoot days and the opportunity to book special offers.Family & Newborn → Individual Photography 98 iris 29 photoshoot 1018 dog 5483 family 6462 photography 9503 event 45199 De Fryske Marren → Balk 224
joure80.nlMunicipality of JoureThe website provides information about an event commemorating the liberation of Joure, taking place on April 27, 2024, at the ‘De Oerdracht’ building in Joure.Neighborhood Organizations → Residents’ Associations 965 History → Historical Events 205 liberation 116 tank 250 bridge 557 film 3007 concert 4409 event 45199 Southwest-Friesland → Sneek 1921
sloeptehuur.nlSloeptehuurSloeptehuur.nl offers the possibility to rent electric sloeps (small boats) on various locations in the Netherlands.Boats → Sloops 129 sloep 127 3d 131 water 2501 rental 7257 Southwest-Friesland → Hommerts 21
restaurantrosemary.nlRosemaryThe Rosemary website is for a restaurant in Friesland, Netherlands, specializing in high-quality, fresh, and locally sourced food, offering a relaxed fine dining experience for lunch, drinks, and dinner.Fine Dining & Gastronomy → Dining 677 reservation 3373 food 3872 newsletter 6504 restaurant 11215 event 45199
outdoor-oudehaske.nlOutdoor OudehaskeOutdoor Oudehaske is a recreational facility located in Oudehaske offering various activities such as footgolf, klompengolf, laser games and the Alleskunner for family outings, corporate events, and children’s parties.Family Gatherings → Family Days 14 Events & Activities → Outdoor Activities 1043 footgolf 22 family outing 25 laser game 142 corporate outing 388 De Fryske Marren → Oudehaske 49
onderdeboog.nlOnder de BoogOnder de Boog is a foodbar located in Joure offering various options for lunch, drinks, high tea and parties.Cafes & Lunch → Lunchroom 446 Nutrition → Healthy Eating 634 play area 173 pastries 946 breakfast 1822 atmosphere 5591 party 5928 dish 5936
ehboweb.nlEHBOWEBThe website provides an overview of EHBO (First Aid) organizations in the Netherlands.Prevention → First Aid 1070 Government & Administration → Government Organizations 1002 ehbo 158 postcode 221 overview 329 knowledge base 569 training 28133 Waadhoeke → Oudebildtzijl 26
grasbanen.nlGrasbanen.nlGrasbanen.nl is a website providing information and a schedule for harness racing meetings on grass in various locations in the Netherlands.Equestrian → Harness Racing 29 race 1043 meeting 2381 schedule 2624 horse 4337 competition 4759 Noordoostpolder → Emmeloord 1649
happinessconcept.nlRainbow JoureRainbow Joure is a location offering a wide range of activities and services for adults and children, with a focus on fun, relaxation, and quality time.Brasseries & Bistros → Bistro 594 Sport Facility → Sports Centers 439 foodbar 21 kids 84 childcare 3512 sport 4228 treatment 21203 Friesland → Leeuwarden 6068
minicamping-weideland.nlMinicamping WeidelandMinicamping Weideland is a cozy campsite in Weststellingwerf, Friesland, offering visitors the opportunity to enjoy peace, space, and nature, with access to diverse natural areas and activities in the surrounding area.Camping → Minicamping 246 recreation lake 20 natural area 208 campsite 2093 accommodation 4921 shop 6483 event 45199 Weststellingwerf → Steggerda 21
vriendenvanmuseumjoure.nlFriends of Museum JoureThe website of Friends of Museum Joure aims to encourage visitors to support the museum by becoming a member or making a donation, enabling important activities such as exhibitions and restoration work.Politics → Activism 237 Museums → Dutch Museums 28 benefits 369 museum 2002 donation 5110 exhibition 5332 association 8562 membership 10442
luxewagen.nlLuxewagenLuxewagen is a car dealer specializing in premium used cars and offers leasing and financing options.Cars → Luxury Cars 107 Leasing → Auto Leasing 565 lease 1595 history 7286 price 8328 car 10865
debruinencho.nlDe Bruin & ChoDe Bruin & Cho is a salon offering hair, spa, and lifestyle services in Lemmer and Joure.Dermatology → Scalp Care 402 Hair Salons → Hair Services 112 hair 3014 salon 5541 treatment 21203 De Fryske Marren → Lemmer 1188
fietsverhuurlemmer.nlBike Totaal Rodenburg LemmerThe website of Bike Totaal Rodenburg Lemmer is an online platform for bicycle rental in Lemmer and surrounding areas, primarily offering the rental of city bikes and electric bikes from the Gazelle brand.Cycling → Bicycle Rental 643 gazelle 34 bicycle shop 99 bicycle 2838 rental 7257 De Fryske Marren → Lemmer 1188
lesalonhairstyling.nlLe Salon HairstylingLe Salon Hairstyling is a hair salon in Joure that offers customers a haircut and a positive experience.Men’s Issues → Men’s Fashion 154 haircut 1158 trend 1865 hair 3014 appointment 13510
vtm-machines.nlVTM MachinesThe website of VTM Machines offers a wide range of machines and attachments for agriculture, the green sector, industry, and construction, and operates as an importer and wholesaler.Machinery & Repair → Machinery 1045 bucket 113 attachment 208 manufacturer 355 machine 3727 assortment 7799
websitebereikt.nlWebsitebereiktWebsitebereikt.nl is a web design agency located in Joure, Friesland, specializing in creating bespoke websites and providing maintenance services with the goal of reaching the target audience and delivering results for clients.Web Design & Development → Digital Marketing 998 results 3954 webdesign 4092 marketing 7107
eetcafehetfar.nlEetcafé 't FarThe website of Eetcafé 't Far describes a restaurant in Terherne that focuses on honest, pure, and attentive food and drink in a pleasant setting, with a historical background of the village of Terherne.Outdoor → Terraces 188 Agricultural Tourism → Agricultural Recreation 105 ice 178 beer 2887 food 3872 atmosphere 5591 history 7286 Heerenveen → Akkrum 246
middelbosjoure.nlMiddelbos JoureThe website of Middelbos Joure is a service-oriented website specializing in the repair, maintenance, and sale of construction machinery and mobile air conditioning systems.Technical Services → Technical 957 Agriculture → Agricultural Machinery & Equipment 631 machinery 519 air conditioning 2178 inspection 4279 sale 5930 repair 14576 maintenance 20093 Netherlands → Drenthe 20062
zijlstrabetontechniek.nlZijlstra BetontechniekThe website of Zijlstra Betontechniek presents services in the field of concrete repair and related specialist works.Building Science & Analysis → Moisture Control 144 plastic flooring 19 concrete repair 59 injection 111 grinding 120
premiumglass.nlPremium GlassThe website of Premium Glass presents their range of exclusive glass products and glass, steel, and wood solutions.Building & Materials → Glass 697 steel 1177 glass 2919 wood 4153
vvvjoure.nlVVV JoureVVV Joure is a tourist information and planning service for trips to Joure and other destinations.Accommodation → Holiday Parks 1024 Vacations → Regional Vacations 28 park 1863 tips 2789 vacation 4234 blog 13392
natuurlijkbijpuur.nlNatuurlijk bij PUURNatuurlijk bij PUUR is a webshop and salon that focuses on selling organic and natural skincare products.Cosmetics & Skincare → Cosmetics 1122 Fashion → Fragrances 598 relaxation 3968 salon 5541 treatment 21203
brdgadvies.nlBRDG AdviesBRDG Advies is a consultancy firm specializing in spatial-economic issues and advising various government and business entities.Local Economy & Development → Regional Development 296 Community → Government & Administration 10567 province 518 municipality 6837 research 8967 Oldambt → Winschoten 830
jagtax-trouwautos.nlJagtax Trouwauto verhuurJagtax Trouwauto verhuur is a company that rents classic and modern Jaguar cars for special occasions, primarily weddings.Rental Services → Car Rental 1047 friesland 692 idea 2367 model 3546 wedding 4258 rental 7257 car 10865
flyerprint.nlFlyer PrintFlyer Print is a printing company located in Joure that offers a variety of printing services, including design, offset printing, digital printing, and direct mail.Printing & Production → Printing 690 Printing & Production → Print Media 207 direct mail 75 press 147 print 5511 design 27202 De Fryske Marren → Balk 224
takelbedrijfhof.nlTakelbedrijf HofTakelbedrijf Hof is a recovery service based in Heerenveen that specializes in the safe recovery of vehicles following accidents or breakdowns, both nationally and internationally.Road Services → Road Transport 400 breakdown 22 recovery 868 address 901 vehicle 3743 transport 6105 insurance 6359 Heerenveen → Akkrum 246
nutjoure.nlNutJoureThe website of NutJoure presents the history, activities, programs and board of directors of the association, which was founded in 1822 to serve the community in Joure.Associations → Village Associations 152 Local Government → Municipal Organizations 416 performance 7586 membership 10442 event 45199
visservice.nlVisserviceVisservice is a company that organizes fully catered fishing trips to Norway.Events → Business Travel 249 SpecificDestinations → Exotic Travel 50 fishing guide 17 fishing trip 20 norway 97 fish 1121 destination 2580 vacation 4234
doopsgezindjoure.nlDoopsgezinde Kerk JoureThe website of the Doopsgezinde Kerk Joure provides information about the church, its activities, services, the 2024 jubilee, the possibility of renting the church building, and the senior pastor Theo de Jong.Protestantism → Mennonite 23 Protestantism → Churches 1009 pastor 208 jubilee 244 church 3439 rental 7257 De Fryske Marren → Balk 224
ogmf.nlOGMFThe website of OGMF (Onderwijsgroep Midden-Friesland) provides information about the collaborative educational organizations OSG Sevenwolden, Bornego College and Bornego Junior College. The aim is to inform prospective students, parents and other stakeholders about the schools and their offerings.Primary Education → School Districts 27 Primary & Secondary Schooling → Secondary Education 1639 board 3438 registration 4366 school 7856 education 13471 Leeuwarden → Grou 366
gjhfinancieeladvies.nlJHJ Financial AdviceThe website of GJH Financial Advice provides financial advisory services, including mortgage advice, pension planning, inheritance and gift planning, and guidance through divorce proceedings, emphasizing honesty, transparency, and affordability.Family Law → Divorce 894 Inheritance Law → Wills 200 inheritance 354 divorce 902 pension 1682 planning 1969 mortgage 4564
obsroute0513.nlOBS Route 0513The website of OBS Route 0513 in Heerenveen presents the school, its mission, programs, and facilities, and provides information for parents and prospective students.Elementary Schools → Public Elementary Schools 406 Pediatric & Child Health → Community Care 141 library 988 parent 4318 student 7623 school 7856 education 13471 Friesland → Heerenveen 2578
safierjoure.nlSafier B&BSafier is a luxurious Bed & Breakfast in Joure that offers a comfortable and personal stay experience.Places → Towns 380 Water Sports → Canoeing 176 b&b 1060 breakfast 1822 boat 2980 building 3204 room 3411 garden 13129 Southwest-Friesland → Sneek 1921
vanlelyveldmakelaardij.nlVan Lelyveld MakelaardijThe website of Van Lelyveld Makelaardij is a platform for buying and selling properties in the Friesland region of the Netherlands. It offers a property listing, valuations, mortgage advice, and other services related to real estate.Property Finance → Purchase 493 Property Sales → Selling Houses 14 realtor 142 purchase 2212 valuation 2697 mortgage 4564 sale 5930 property 7406 Waadhoeke → Tzum 30
pax.nlPAX GroepPAX Groep provides logistical solutions for various industries, including construction and industry, offering services ranging from internal transport to international shipping and project management.Urban Delivery → Urban Logistics 20 logistics 3257 ship 5103 transport 6105 Alphen aan den Rijn → AWZI Alphen a/d Rijn 358
defion.nlDefion BVDefion is a power electronics development company that offers a range of services including product certification, development, prototyping, and design.Computer Science → Embedded Systems 141 Engineering → Engineering Firms 989 prototype 603 certification 3380 design 27202
brouwerongediertebestrijding.nlBrouwer Ongediertebestrijding VofBrouwer Ongediertebestrijding provides professional pest control services in the Heerenveen, Joure, and Friesland region.Control → Pest Control 824 biocide 10 pest 354 control 911 plan 2566 environment 4873 Friesland → Heerenveen 2578
jouregio.nlUrgendaThe website Jouregio presents local news and events from the Fryslân region, with a focus on the town of Joure.Blogs & Publications → Regional 272 nature 9094 news 15293 event 45199
beyondnow.nlBeyond NowBeyond Now is an organization focused on creating surprising and impactful living environments and promoting healthy and inclusive communities.Social Issues → Community Development 330 Living → Living Environment 73 green 889 festival 3804 home 7976 collaboration 16036
noordnederlandinterieurs.nlNoord Nederland InterieursNoord Nederland Interieurs is an interior company specializing in custom-made furniture and interior construction, with a long history and a focus on customer satisfaction and sustainability.Woodwork → Wooden Furniture 476 interior 8093 furniture 8751 sustainability 18451 Arnhem → Schuytgraaf-Noord 54
autorecyclingjoure.nlAutorecycling Joure b.v.The website of Autorecycling Joure describes an auto salvage yard that sells car parts, donor cars, and tires, and is committed to environmental protection.Waste Management → Waste Processing 96 Road Services → Automotive 18764 auto parts 44 waste 1312 tire 1975 valuation 2697 part 5044
technieker.nlTechniekerThe website ‘Technieker’ is a job board specializing in technical roles, with a focus on the manufacturing and processing industry in Northern Netherlands. The aim is to offer challenging career opportunities to professionals seeking a new challenge.Technical Services → Technical 957 Employment & Labor → Employers 608 position 875 motivation 894 automation 2682 vacancy 6598 technology 6816 Northeast-Friesland → Dokkum 846
delichtadviseurs.nlDE lichtadviseursThe website of DE lichtadviseurs is a platform that provides lighting advice, lighting supply and installation services to professionals and individuals, with a focus on a total solution and a wide range of brands.Lighting → LED Lighting 574 Consulting → Lighting Consulting 78 lighting advice 52 lighting plan 200 light 5148 assortment 7799 quote 12863 Smallingerland → Drachten 2052
vvbl.nlVereniging van Bedrijven Lemmer en omstrekenThe Vereniging van Bedrijven Lemmer en omstreken (VVBL) is a business association focused on fostering collaboration, knowledge sharing, and networking among companies in Lemmer and the surrounding area. The website provides information about events, members, contact details, and opportunities to join.Associations → Regional Associations 292 networking 842 member 10154 collaboration 16036 event 45199 Southwest-Friesland → Heeg 227
hen3ka.nlHen3kaThe website Hen3ka.nl offers interior design advice, home decor and upholstery services to individuals and businesses, provided by a certified interior designer and stylist.Decor & Furnishings → Interior Design 2317 home decor 400 upholstery 673 online shop 1310 atelier 1417 interior design 1802 De Fryske Marren → Sint Nicolaasga 146
natuurbegraafplaatsfriesland.nlNatuurbegraafplaatsen FrieslandThe website provides information about natural burial grounds located in Friesland, Netherlands, and details about the practice of natural burial and available locations.Life Events → Death 687 Funeral Services → Funeral Arrangement 486 natural burial ground 15 natural burial 25 friesland 692 brochure 1642 De Fryske Marren → Sondel 14
hieke.nlHieke KramerThe website of Hieke.nl offers graphic design and web design services, with a focus on designing logos, brand identities, websites, and print materials for businesses and individuals in the Joure, Heerenveen, and surrounding area.Design → Graphic Design 2433 print materials 57 brand identity 1457 logo 4660 communication 10162 brand 17737 Southwest-Friesland → Sneek 1921
w2n.nlW2N EngineersThe website of Bouwkundig ingenieursbureau W2N Engineers presents the services of a civil engineering firm that provides multidisciplinary advice on construction, building physics, and energy performance, with a particular focus on roof checks for solar panels.Engineering → Engineering Firms 989 building physics 47 energy performance 47 construction 7421 Smallingerland → Drachten 2052
warniermetaal.nlWarnier MetaalThe website of Warnier Metaal describes their activities as a company specializing in metalworking, machine construction, and the provision of various products and services to different industries.Metalworking → Welding 893 Technology → Robotics & Automation 860 machine construction 146 robotics 281 cnc 305 metalworking 565
keurtekens.nlKeurtekensThe Keurtekens.nl website provides information about hallmarks, master hallmarks, importer's marks, and responsibility marks used in gold, silver, and platinum, focusing on the Guarantee Act and the CCM convention. The website also offers information about testing gold and silver and the meaning of year letters.Investing → Precious Metals 326 Government & Administration → Legislation 432 hallmark 23 silver 479 gold 805 Krimpenerwaard → Schoonhoven 544
dox.nlDox ImagemakersThe website of Dox Imagemakers from Joure offers advertising and signage materials aimed at strengthening brand identity and attracting customers.Advertising → Lettering 569 carwrap 42 facade 1490 advertising 2302 design 27202
autojourexl.nlAuto Joure XLAuto Joure XL is an auto dealership located in Joure that specializes in the sale, financing, and export of used cars.Leasing → Auto Leasing 565 Financing → Leasing 1065 export 630 used car 825 lease 1595 warranty 4701 finance 5341
partytenthuren-friesland.nlPartytentverhuur FrieslandThe website offers tent rentals and various accessories for events in Friesland.Event Rental → Tent Rental 437 Events & Hospitality → Catering Equipment 50 tent 1328 floor 4781 light 5148 furniture 8751 accessories 12975 event 45199 Northeast-Friesland → Dokkum 846
vajoure.nlVoetbalacademie JoureThe website of Voetbalacademie Joure presents a training program for footballers and goalkeepers, aimed at children aged 7 to 16, and offers training sessions and events in Joure, Bolsward, and Wolvega.Sports & Fitness → Sports Training 711 football academy 10 goalkeeper 62 tournament 2476 training 28133 Weststellingwerf → Wolvega 524
kajoure.nlKeepersacademie JoureThe Keepersacademie Joure provides training for goalkeepers aged 7 to 16, with the goal of developing their talent and helping them improve.Education → Sports Education 247 goalkeeper 62 level 494 academy 593 talent 3987 collaboration 16036 training 28133 Weststellingwerf → Wolvega 524
karenvisserontwerp.nlKaren Visser Graphic DesignThe website of Karen Visser Graphic Design showcases a portfolio of graphic design work, ranging from posters and logos to stand and packaging designs, and offers services for various projects.Design & Creative → Graphic Services 1003 stand 294 poster 837 brand identity 1457 brochure 1642 packaging 2236 logo 4660 De Fryske Marren → Balk 224
eclatant.nlEclatant Cleaning CompanyThe website of Eclatant Cleaning Company is dedicated to offering professional cleaning services to both private and business customers, with a wide range of specialties including window cleaning, floor maintenance, facade cleaning, and emergency services.Maintenance & Repair → Facility Services 671 floor maintenance 188 window cleaning 348 emergency service 372 facade cleaning 385 cleaning 4567 Westerkwartier → Zuidhorn 286
astridwormgoor.nlAstrid WormgoorThe website of naturopathic practitioner Astrid Wormgoor presents her services in the areas of bioresonance, nutritional advice, and massage, aimed at improving the health and vitality of her clients.Alternative Medicine → Orthomolecular Medicine 340 Alternative Medicine → Naturopathy 1097 digestive issues 44 bioresonance 137 nutritional advice 317 health 6366 massage 7646 Utrecht → Amersfoort 8011
autogroothandelfriesland.nlAutogroothandel Friesland B.V.The website of Autogroothandel Friesland is a wholesaler specializing in vehicles for business clients and selling used cars, excluding sales to private individuals. The company offers a wide selection, expert advice, and export services.Car Selling & Valuation → Passenger Cars 992 export 630 inventory 1613 price 8328 car 10865
deblijepapegaai.nlStichting De Blije PapegaaiThe Blije Papegaai is an organization that hosts birthday parties, workshops, and craft kits.Workshops → Children’s Workshops 77 Family Fun → Family Activities 1493 craft kit 45 birthday party 223 friesland 692 workshop 19325 Friesland → Leeuwarden 6068
gymnasionjoure.nlVereniging Exclusieve SportcentraSportcentrum Gymnasion in Joure offers a wide range of sports and fitness options, including swimming lessons, group classes, and personal coaching, with the goal of helping customers improve their quality of life.Group Class → Fitness Centers 1010 Personal & Household → Fitness Services 162 gym 699 swimming 850 group classes 1306 fitness 2251 membership 10442 coach 25810
piaservice.nlPIA Service BVThe website PIA Service presents itself as a provider of industrial automation solutions, specifically focused on processing and production machines and processes in the food and non-food sector. The company offers software, service, and consultancy services, with the goal of optimizing production processes.Automation & Control → Automation 1494 Industrial → Industrial Automation 1042 process control 13 scada 37 iot 183 automation 2682 production 4582 software 8291 South-Holland → Alphen aan den Rijn 3978
edwinstichting.nlEdwin StichtingThe website of the Edwin Foundation presents a wheelchair-accessible holiday home, The Edwin House, located in the watersport village of Langweer, with the aim of enabling groups with people with disabilities to enjoy a pleasant holiday.Accommodation → Holiday Parks 1024 Water Sports → Sailing 1501 wheelchair accessible 11 holiday home 2753 boat 2980 foundation 6678 Southwest-Friesland → Sneek 1921
wokming.nlWOK MINGThe website of WOK MING in Joure presents an all-inclusive wok restaurant with takeaway, catering, and reservation options, and offers a selection of Asian dishes, including soups, woks, sushi, and teppanyaki.Japanese → Sushi 971 Catering & Ready Meals → Asian Restaurant 163 wok 231 soup 1043 sushi 1695 catering 6456 restaurant 11215
watervillaxxl.nlWatervillaXXLWatervillaXXL is a website that rents out spacious, independent holiday villas in Friesland, Netherlands, offering various arrangements and amenities.Accommodation → Villas 1018 Nature → National Parks 898 canoe 269 friesland 692 sauna 1175 villa 1351 water 2501 restaurant 11215 De Fryske Marren → Terherne 98
slagerijdol.nlSlagerij DolThe Slagerij Dol website is an online shop and local butcher shop with a long tradition, selling fresh meat, meat products, delicatessen, and barbecue products, with delivery service in various villages in the area.Supermarkets & Grocery → Butchers 747 sausage 256 barbecue 1175 meat 2055 assortment 7799 De Fryske Marren → Boornzwaag 17
wijnkoperij-joure.nlWijnkoperij JoureWijnkoperij Joure is a webshop and physical store offering a wide selection of wines and whiskies.Wine → Wine Tasting 730 Gifts & Souvenirs → Wine Shops 796 whisky 373 taste 933 wine 4476 gift 6442 webshop 8648
pompebledsjes.nlPompeblêd Sieraden WebshopThe website is a webshop selling pompeblêd (a Friesian flower) jewelry in gold and silver, designed and handcrafted by Simone in Joure.National Identity → Frisian Culture 11 jewelry 4599 webshop 8648 workshop 19325
woningscharsterbrug.nlWoning ScharsterbrugThe website offers rental of a house in Scharsterbrug, Friesland, focusing on exploring the surrounding area and providing activities for families and friends.Accommodation → Bungalows 1008 Accommodation → Bungalow Parks 931 watersport 540 hiking 841 swimming pool 1664 cycle 1906 house 8121 Amsterdam → Sloten 146
parkmanagementbolsward.nlVereniging Parkmanagement BolswardThis website provides information about park management and the stakeholders involved in the business park of Bolsward.Municipalities → Governance 1043 Commercial Property → Business Parks 324 park management 65 business park 372 municipality 6837 collaboration 16036 Southwest-Friesland → Bolsward 566
zorginsudwest.nlGemeente Súdwest-FryslânThe website ‘Zorg in Súdwest-Fryslân’ is a platform of the municipality of Súdwest-Fryslân where residents can express their opinions on the future of healthcare in the municipality, specifically regarding the potential closure of hospitals and the development of new facilities.Municipalities → Súdwest-Fryslân 11 Health → Medical Care & Services 29461 opinion 417 hospital 560 healthcare 2316 plan 2566 Southwest-Friesland → Sneek 1921
schaapbron.nlSchaap & BronSchaap & Bron is a VAG specialist offering car dismantling, maintenance, and repair services.Tires → Tire Retailers 182 automaterials 14 mot 806 part 5044 repair 14576
breimersbakkerij.nlConsumenten webshopThe website of Breimer's Bakkerij is an online shop where customers can order bread, rolls, pastries, cakes, cookies, chocolate and candies. The webshop also provides information about locations and offers a delivery service.Pastry → Cakes 826 Supermarkets & Grocery → Food Stores 1058 delivery service 236 bakery 718 shop 6483 order 6912 assortment 7799 De Fryske Marren → Lemmer 1188
trekzakclubjoure.nlTrekzakclub van JoureThe website of the Trekzakclub of Joure presents the club, its activities, and agenda.Performing Arts → Music Groups 100 accordion 165 club 4225 atmosphere 5591 member 10154 music 13170
provier.nlProvier VastgoedadviseursThe website of Provier Vastgoedadviseurs offers an overview of available real estate properties for sale and rent in Northern Netherlands and provides real estate consulting, management, and appraisal services to both private and institutional investors.Property Finance → Purchase 493 Property Technology & Data → Real Estate Research 20 brokerage 433 appraisal 1488 consulting 3639 real estate 4981 portfolio 6854 Southwest-Friesland → Bolsward 566
edwinpietersma.nlEdwin Pietersma Training & AdviesThe website of Edwin Pietersma Training & Advies offers a range of EHBO (First Aid), BHV (Fire Safety), Reanimation and AED courses, aimed at educating individuals and companies to respond adequately to emergencies.Prevention → First Aid 1070 Safety → Fire Safety 1048 risk assessment 133 certification 3380 course 14728 training 28133 Steenwijkerland → Giethoorn 565
tighbarra.nlTigh BarraTigh Barra is an Irish pub and pop venue located in Joure that offers a selection of Irish beers, whiskeys, live music, and events.Pubs → Irish Pubs 11 Performance → Live Music 1612 whiskey 78 pub 185 beer 2887 terrace 4847 music 13170
joure-touristinformation.nlJoure, Langweer and Terherne Tourist InformationThis website provides tourist information for the municipalities of Joure, Langweer, and Terherne in Friesland, Netherlands.Tourism → Regional Tourism 242 tourism 303 boat 2980 accommodation 4921 shop 6483 De Fryske Marren → Terherne 98
bobkeukenbouwer.nlBob KeukenbouwerBob Keukenbouwer is a kitchen specialist located in Joure, Friesland, offering new kitchen design, renovation, and sales of kitchen equipment and accessories.Kitchen → Kitchen Renovation 260 Kitchen → Kitchen Design 443 kitchen blade 18 kitchen renovation 24 kitchen equipment 98 showroom 4883 kitchen 6443 Zwartewaterland → Hasselt 490
hayfever.nlHayfeverThe website of Hayfever, a Dutch cover band, showcases their repertoire, schedule, and booking options.Rock → Dutch Rock 54 Live Music → Cover Bands 433 rocknroll 15 repertoire 2497 schedule 2624 band 2977 music 13170 event 45199 Achtkarspelen → Harkema 113
kostenboekhouder.nlOnbekendThis website provides a directory of bookkeepers located in various regions of the Netherlands.Business Software → Accounting Software 984 Taxation → VAT 266 income tax 61 bookkeeper 80 vat 432 administration 6587 price 8328 Midden-Groningen → Slochteren 137
blinkadmin.nlBlinkThe website of Blink describes a financial advisory firm offering administrative services, tax advice, and collaborative partnership to businesses and individuals.Business Support & Advisory → Advisory 413 annual account 399 tax 2100 administration 6587 collaboration 16036
vogelwachtjoure.nlVogelwacht Joure e.o.Vogelwacht Joure e.o. is a nature-loving association dedicated to bird protection and conservation.Nature → Nature Organizations 104 Environment → Conservation 328 protection 728 bird 922 monitor 1063 photo 7778 association 8562 nature 9094 Assen → Witten 128
haskerfjild-meilan.nlIt HaskerfjildThe website of It Haskerfjild, part of CBO Meilan, presents the school, its objectives, facilities, and offerings to prospective students and parents.Elementary Schools → Christian Primary Schools 342 Government & Administration → Local Municipalities 219 parent 4318 student 7623 school 7856 education 13471 Friesland → Heerenveen 2578
debroek.nlWatersportbedrijf De BroekWatersportbedrijf De Broek is a watersport rental company located in Broek, Friesland, offering boat rentals.Boating → Marinas 825 motorboat 128 boat 2980 De Fryske Marren → Lemmer 1188
dutchopengrasstrack.nlDutch Open Grass TrackThe website of the Dutch Open Grass Track provides information about competitions, events, and news related to this competition.Chess → Chess Clubs 261 Motor → Motorsport 1438 competition 4759 news 15293 event 45199 Tynaarlo → Vries 168
pknearnewald.nlPKN Gemeente EarnewâldThe website of the PKN (Philippine Korean Network) church in Earnewâld provides information about the church services, activities, history, and contact details of the community.Catholic → Parishes 457 Local Communities → Villages 1005 church bulletin 23 church council 34 church service 879 history 7286 collection 7566 Northeast-Friesland → Ia 40
julianus.nlBouwbedrijf JulianusBouwbedrijf Julianus is a construction company specializing in maintenance, renovation, remodeling, and restoration of historical buildings and homes, with a focus on sustainability and the preservation of traditional craftsmanship.Windows → Window Frames 130 window frames 224 craftsmanship 1858 restoration 3417 renovation 13849 sustainability 18451 Waadhoeke → Marsum 58
mxhotshots.nlMXHotShotsThe website provides an overview of various motorsport events, primarily cross-country races and training sessions.Motor → Motorsport 1438 dmx 12 cross 88 race 1043 category 2316 training 28133 Noordoostpolder → Rutten 62
oudjoure.nlN.V.The website Oud Joure presents the history, culture, and traditions of the village of Joure, with a focus on the Vlecke and the Old Land and Waterways.Social Sciences → Folklore & Mythology 43 Traditional Practices → Folklore 121 folklore 19 tradition 736 Katwijk → Katwijk aan Zee 616
fotogroepinfocus.nlFotogroep InFocus ZuidhornThe Fotogroep InFocus Zuidhorn website showcases their photo assignments and exhibitions from seasons 21-24, including themes such as ‘Splashing Goodbye!’ and ‘The Suikerbiet(en) Campaign’. The aim is to share and promote their photographic work.Planning → Tours 870 Activities → Excursions 257 excursion 662 assignment 1121 theme 4015 exhibition 5332 photography 9503 Westerkwartier → Zuidhorn 286
makelaardijdraijer.nlChris Draijer Makelaardij B.V.Chris Draijer Makelaardij is a real estate agent and appraiser operating in the Southwest Friesland region, assisting with the purchase and sale of homes and commercial properties.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Regional Agencies 215 commercial property 469 appraisal 1488 purchase 2212 sale 5930 property 7406 house 8121 Southwest-Friesland → Workum 363
gitaarschoolfriesland.nlGitaarschool FrieslandGitaarschool Friesland offers guitar and bass guitar lessons in Leeuwarden, Heerenveen and Joure, with a personalized approach and free trial lessons.Instrument → Guitar 576 Music Education → Guitar Lessons 403 bass guitar lesson 14 guitar lesson 306 style 2348 teacher 2890 lesson 5154 Friesland → Leeuwarden 6068
taxi-jeroen.nlTaxi JeroenThe website of Taxi Jeroen offers taxi services in Heereveen and surrounding areas, including airport taxi, catering taxi, street taxi, school transport, and personal budget transport.Taxi → Regional Taxis 86 ride 1075 taxi 2090 transport 6105 appointment 13510 Heerenveen → Akkrum 246
imj.nlIMJIMJ is a civil engineering firm providing construction engineering services for various building projects.Engineering → Engineering Firms 989 Civil & Infrastructure → Construction Engineering 53 buildings 898 staff 3405 construction 7421 Southwest-Friesland → Koudum 134
lemsterpark.nlDe Kompanjon BVThe website of Lemsterpark presents a business park located in Lemmer, Friesland, suitable for companies and offices and offering an attractive location for establishment.Commercial Property → Business Parks 324 Civil & Infrastructure → Roads 252 phase 76 business park 372 plot 1051 transportation 2851 De Fryske Marren → Lemmer 1188
zuidfrieslandonstage.nlOn StageThe website ‘Onderwijs On Stage’ presents information and events related to the VMBO On Stage activity in South Friesland.Special Needs & Support → Educational Organizations 315 Employment & Labor → Labor Market 580 vmbo 198 partner 4272 school 7856 event 45199 De Fryske Marren → Balk 224
janvermaning.nlJan VermaningThe website of Jan Vermaning presents a musician active as a conductor, trumpeter, and cultural project organizer.Education & Training → Conducting 99 Culture → Cultural Industries 24 trumpeter 10 musician 1207 conductor 1217 orchestra 1315
janhooglandmechanisatie.nlJan Hoogland MechanisatieThe website of Jan Hoogland Mechanisatie presents the current stock of tractors, attachments, machines and other agricultural equipment, as well as rental options and news.Machinery & Repair → Tractors 266 Trade → Agricultural Trade 97 attachment 208 tractor 789 stock 1154 machine 3727 rental 7257 De Fryske Marren → Sint Nicolaasga 146
westerhofmakelaardij.nlWesterhof MakelaardijWesterhof Makelaardij is a real estate agency located in Akkrum and Nes, specializing in the sale and purchase of properties, property appraisals, and valuation services.Property Advice & Guidance → Property Transactions 184 Real Estate → Regional Agencies 215 agent 1253 appraisal 1488 valuation 2697 property 7406 appointment 13510 Heerenveen → Akkrum 246
hestertadema.nlREALISATIE LAAGLAND MEDIAThe website of Hester Tadema presents her as a singer and entertainment artist, with information about her performances and bookings.Performance → Live Music 1612 Recordings & Media → Singers 844 single 445 performance 7586 book 11396 music 13170 event 45199 Heerenveen → Katlijk 43
klusservicenijdam.nlKlus-Service NijdamThe website of Klus-Service Nijdam is a company offering complete handyman services, including maintenance, renovation, and especially bathroom and toilet renovations.Renovation → Bathroom Renovation 834 Installation & Repair → Handyman Service 70 carpenter 220 electrician 819 tile 2869 bathroom 3784 renovation 13849 Groningen → Haren 805
bouwbedrijf-bruinsma.nlBouwbedrijf Bruinsma BVThe website of Bouwbedrijf Bruinsma in Heerenveen offers services for new construction, renovation, maintenance, and repair of various types of buildings.Architecture → Historical Buildings 266 Building & Materials → Carpentry & Joinery 830 new construction 2672 building 3204 construction 7421 renovation 13849 maintenance 20093 Heerenveen → Skoatterwâld 14
klokkenstoel-goingarijp.nlklokkenstoel-goingarijp.nlThe website klokkenstoel-goingarijp.nl is an information page about the village of Goingarijp in the province of Friesland, with descriptions of the local environment, walking and cycling routes, and local history.Hiking → Walking Routes 226 cycling route 451 history 7286 nature 9094 installation 13742 sustainability 18451 De Fryske Marren → Goingarijp 86
cafethert.nlCafé 't HertCafé 't Hert is a unique pub in Joure offering event space rentals for various occasions.Brasseries & Bistros → Bistro 594 led screen 63 venue 879 bar 1216 terrace 4847 event 45199
domien.nlDomien Silvius Spuit- & SchilderwerkDomien Silvius Spuit- & Schilderwerk is a company that offers painting, spraying, and metal conservation services.Home Improvement → Decorating 333 Household & Cleaning → Spraying 387 spray 658 metal 1090 paint 8747
sporza-fitness.nlSporzaSporza is a fitness center located in Joure, Grou, and Bolsward, offering high-quality fitness equipment and various activities including group classes, personal training, and corporate fitness.Group Class → Fitness Centers 1010 Human Resources → Corporate Fitness 74 cardio equipment 22 strength equipment 31 corporate fitness 34 fitness center 46 group classes 1306 Southwest-Friesland → Bolsward 566
zwemschooldefryskemarren.nlZwemschool De Fryske MarrenZwemles Joure is a website of Zwemschool De Fryske Marren offering swimming lessons and promoting swimming safety for children.Water Activity → Swimming 1402 diploma 795 swimming 850 water 2501 instructor 3126 safety 5819
zvv-haskerland.nlZVV HaskerlandThe website of ZVV Haskerland, a hall football club from Joure, presents information about the club, its teams, history and news.Football → Youth Football 202 Football → Indoor Football 108 knvb 34 competition 4759 history 7286 news 15293 De Fryske Marren → Sint Nicolaasga 146
bregepopfestival.nlBregepopThe website provides information about the Bregepop Festival, which takes place on April 12th and 13th, 2024, in Scharsterbrug, Friesland, marking the start of the festival season in the north.Festivals → Music Festivals 1020 site 422 visitors 1048 festival 3804 performance 7586 De Fryske Marren → Scharsterbrug 16
stokerkoffiebar.nlStoker Coffee BarThe Stoker Coffee Bar website introduces the coffee bar, its menu, and an upcoming webshop, inviting visitors to visit the location in Joure.Beverages → Tea 829 Gifts → Gift Cards 981 coffee bar 111 coffee beans 452 lunch 1534 coffee 3838 drink 5191 atmosphere 5591
oefentherapiefriesland.nlOefentherapie FrieslandOefentherapie Friesland offers physiotherapy services in various locations in Friesland with extensive experience in helping people with various complaints.Pain → Pain Syndromes 12 Physical Therapy → Exercise Therapy 354 muscle 498 posture 548 movement 2304 physiotherapy 4688 complaint 6479 De Fryske Marren → Balk 224
gmrambion.nlGMR AmbionThe GMR Ambion website provides information and resources for the members of the collective employee representation council of the Ambion public school network, representing the staff and parents of schools in the Joure and Heerenveen regions.Municipalities → Governance 1043 Social Issues → Participation 1023 representation 100 budget 1335 meeting 2381 Friesland → Heerenveen 2578
jumbojoure.nlJumbo Joure ZijlstraThe website of Jumbo Joure Zijlstra presents the store, its opening hours, assortment and social media channels.Websites → Local Businesses 85 Supermarkets & Grocery → Local Supermarkets 56 fresh 26 artisanal 56 opening hours 2953 store 3901
autobedrijfjentjezantema.nlAutobedrijf Jentje ZantemaAutobedrijf Jentje Zantema is an automotive dealership focused on reliable and high-quality vehicles and offers financial lease and financing options.Car Selling & Valuation → Passenger Cars 992 reliability 235 lease 1595 showroom 4883 car 10865
bouwkemper.nlKemper BouwKemper Bouw is a construction company offering building and renovation services in the area around Sneek and Scharnegoutum.Construction Companies → Construction Contractors 536 Building & Materials → Carpentry & Joinery 830 construction company 824 carpentry 2218 new construction 2672 renovation 13849 maintenance 20093 Heerenveen → Akkrum 246
atsmaschoon.nlAtsma SchoonmaakbedrijfAtsma Schoonmaak is a professional cleaning company providing services in Joure and surrounding areas.Local & Regional Focus → Local Businesses 1077 Notaries → Notary Office 82 office 2898 employee 4429 cleaning 4567 home 7976 price 8328
muurling.nlH.J. Muurling AssurantiënMuurling Assurantiën Joure is an independent insurance broker office that provides financial security to individuals and entrepreneurs in Joure, since 1993.Insurance & Risk → Insurance Brokerage 244 advisor 1055 reviews 3172 mortgage 4564 insurance 6359 sustainability 18451
holtropbeheer.nlA.Holtrop Beheer b.v.A.Holtrop Beheer b.v. is a company specializing in project development, workplace housing, and participations.Investing → Real Estate Investing 707 Real Estate → Project Development 633 workplace housing 16 project development 215 commercial property 469 Hardenberg → Dedemsvaart 413
meimekoar.nlMei MeKoarThe website of Mei MeKoar describes the activities of a choir, particularly their involvement in commemorating victims of World War II in Jirnsum and their participation in various musical events.World War II → Remembrance 120 commemoration 181 ceremony 824 choir 3123 music 13170 event 45199 Friesland → Leeuwarden 6068
ratechniek.nlRA TechniekRA Techniek is a technical installation company based in Joure that provides advice and installation services for residential and commercial spaces.Installation & Mounting → Construction Installation 175 ventilation 1110 electrical 1414 heat 2188 bathroom 3784 kitchen 6443 installation 13742
jousterhuisartsen.nlJouster House PhysiciansThe website of Jouster House Physicians provides information about the practice, the treating doctors, various healthcare services, and practical information for patients.Patient Services & Rights → Patient Information 158 Medical Care & Services → Primary Care 5699 general practitioner 508 prescription 859 healthcare 2316 patient 4082 practice 9089 appointment 13510
mattheusjoure.nlIKC Sint MattheüsThe website of IKC Sint Mattheüs provides information about the integral child center, including childcare, education, and contact information.Primary Education → Catholic Primary Education 380 Childcare → After-School Care 765 director 716 center 1115 daycare 1365 school 7856 education 13471 collaboration 16036
pandhuys.nlPandhuysThe website of Pandhuys Joure offers services for the melting and selling of gold and silver jewelry.Investing → Precious Metals 326 Accessories → Jewelry 3517 cash 61 precious metal 78 jewelry 4599
larsmulder.nlHal Leonard MGBThe website presents the works and background of composer Lars Mulder.Composition & Theory → Composers 175 Personal → Biography 1003 composer 412 composition 639 piano 820 choir 3123 music 13170 Eemsdelta → Delfzijl 615
kunstgebitfriesland.nlKunstgebit FrieslandKunstgebit Friesland provides denture repair, new dentures, and cleaning services to residents of Friesland, offering free pickup and delivery.Dentistry → Dentures 88 denture 462 insurance 6359 repair 14576 Smallingerland → Drachten 2052
local-vocals.nlThe Local VocalsThe website of The Local Vocals presents an enthusiastic women's choir based in Joure, Friesland.Choir → Women’s Choir 179 Education & Training → Singing 878 singing 1056 repertoire 2497 choir 3123 member 10154
moaiskarsterlan.nlVereniging Moai SkarsterlânThe Vereniging Moai Skarsterlân is a association dedicated to protecting the landscape, flora, fauna, and living environment of the region.Nature → Nature Organizations 104 Nature Conservation → Landscape Conservation 114 fauna 143 flora 171 landscape 2609 newsletter 6504
boersmaschoenen.nlBoersma SchoenenThe website of Boersma Schoenen presents an online shop with shoes and accessories, as well as information about the stores in Joure and Grou.Shoes → Men’s Shoes 153 Shoes → Women’s Shoes 164 shoes 2699 store 3901 brand 17737 Leeuwarden → Grou 366
vamosvastgoed.nlVAMOS Vastgoed B.V.Vamos Vastgoed is a real estate advisory and brokerage firm that operates with both its own and external portfolios.Real Estate & Investment → Intangible Assets 123 transaction 613 real estate 4981 portfolio 6854 communication 10162 collaboration 16036 Friesland → Heerenveen 2578
geleendegezichten.nlStichting Geleende GezichtenThe website ‘Geleende Gezichten’ presents information about a historical art project by visual artist Ada Stel, linked to the municipality of Joure. The project encompasses portraits, including works from the ‘Geleende Gezichten’ series and portraits of children who lost their lives during World War II.Specialized History → World War II 1134 lecture 1624 portrait 3685 exhibition 5332 Waadhoeke → Franeker 694
burostadenland.nlBuro Stad en LandBuro Stad en Land provides advice and design plans for spatial planning, with a focus on landscape design, urban planning, and sustainability.Urban Planning → Public Space 188 Planning & Development → Spatial Planning 889 visualization 621 planning 1969 landscape 2609 design 27202 Noordenveld → Norg 322
dekanoniers.nlKanovereniging De Kanoniers Joure e.o.Kanovereniging De Kanoniers Joure e.o. is a canoeing association that organizes sailing evenings and other activities.Boating → Marinas 825 Water Sports → Canoeing 176 canoe 269 evening 287 clubhouse 784 association 8562 member 10154
happyescortfriesland.nlHappy Escort FrieslandThe website is an escort agency offering Dutch escort girls in Friesland and surrounding provinces.Adult Content → Escort Services 96 Transportation → Travel Services 122 escort service 11 order 6912 Friesland → Leeuwarden 6068
dkd-lasopleidingen.nlDKD LasopleidingenDKD Lasopleidingen Joure offers welding training, certification for welders and companies, and welding advice.Machine Shops & Welding → Welding Technology 115 Business & Management → Certification 364 welding training 10 certification 3380
igrotech.nlIgrotech InstallatietechniekIgrotech Installatietechniek is an installation company based in Heeg offering a wide range of plumbing and installation services.Heating → Boilers 336 boiler 1240 electrical 1414 plumbing 1761 air conditioning 2178 heat 2188 solar panels 4701 Southwest-Friesland → Heeg 227
bloemisterijdeswanneblom.nlDe Swanneblom BloemenDe Swanneblom Bloemen is a flower shop offering flowers and floral arrangements for various occasions, with a particular focus on funeral flowers and wedding flowers.Florists → Online Flower Shops 293 Online Retail → Gift Certificates 225 bridal bouquet 47 funeral flowers 199 floral arrangement 344 online shop 1310 flowers 3248
silleke.nlSillekeThe website of Silleke offers creative workshops for adults and children in Friesland and Groningen, focusing on a cozy and relaxing learning environment.Hobbies → Creative Hobbies 412 Painting → Abstract Painting 594 calligraphy 69 drawing 1101 creativity 2531 paint 8747 workshop 19325 Smallingerland → Drachten 2052
logopediejoure.nlLogopediepraktijk JoureThe Logopedie Joure website provides information about speech therapy services for various communication disorders, including stuttering, language problems, and preverbal disorders, and showcases the practice’s services.Childcare → Language Development 574 Learning Disabilities → Dyslexia 438 stuttering 71 play therapy 130 speech therapy 540 language 2016 communication 10162 treatment 21203
verloskundeskarsterlan.nlVerloskundigenpraktijk SkarsterlânThe website of Verloskundigenpraktijk Skarsterlân in Joure provides information and services related to pregnancy, childbirth, and postpartum care.Doctors → Midwives 89 Pregnancy & Childbirth → Midwifery 619 lactation 10 postpartum care 236 ultrasound 769 childbirth 894 pregnancy 2739
eddyeefting.nlSVR Camping EeftingThe website of SVR Camping Eefting presents a farm stay located near the Tjeukemeer in Friesland, offering relaxation, space and activities for guests of all ages.Parks → Recreation Parks 37 Water → Lakes 232 tjeukemeer 11 camp 2466 facility 2616 horse 4337 De Fryske Marren → Balk 224
fotogeaveenstra.nlFotogea VeenstraThe website offers photography courses and workshops covering landscape, flowers, animals, macro photography, and digital editing.Artistic Expression → Fine Art Photography 502 canvas 694 artwork 2248 horse 4337 photography 9503 course 14728 workshop 19325 Wassenaar → Duindigt 15
zwembadengids.nlZwembadgids.nlThe website zwembadgids.nl is an online directory that collects all swimming pools and swimming schools in the Netherlands.Business Marketing → Online Marketing 34 Garden → Swimming Pools 601 rating 217 benefits 369 swimming pool 1664 reviews 3172 registration 4366 Noordenveld → Norg 322
lingeriegids.nlLingeriewinkelgids B.V.The website lingeriegids.nl is a directory for all lingerie stores in the Netherlands. The goal is to help potential customers find lingerie stores in their area and to help lingerie stores increase their online visibility.Websites → Information Sites 174 Underwear → Lingerie 471 benefits 369 reviews 3172 Dronten → Swifterbant 217
kooystrapro.nlKooystra ProfessioneelKooystra Professioneel is a company providing services and products for event technology, including livestreaming, installations, and rental of audio, lighting, and video equipment.Event Resources → Event Technology 259 Technology → Audiovisual & Media 688 livestream 478 audio 934 light 5148 video 6714 installation 13742 event 45199
pyro-outlet-joure.nlPyro Outlet JourePyro Outlet Joure is a firework shop that offers a wide selection of fireworks at outlet prices to residents of Joure and the surrounding area.Party Supplies → Fireworks 258 Parties → New Year’s Eve 71 cakeboxes 13 fountain 96 fireworks 413 box 1982 package 6112
huiskoopadvies.nlTer Hart Huiskoopadvies en TaxatiesThe website of Ter Hart Huiskoopadvies en Taxaties offers services for buying a home, including property brokerage, appraisals, and comprehensive purchase packages.Real Estate → Property Valuation & Appraisal 2123 appraisal 1488 package 6112 Smallingerland → Drachten 2052
frankmeesterfotografie.nlFotograaf Frank MeesterThe website of Fotograaf Friesland showcases the services of Frank Meester, a photographer specializing in business photography, studio photography, and lifestyle photography, with a focus on relaxed and authentic photographs.Commercial Work → Commercial Photography 731 corporate report 18 business photography 104 photoshoot 1018 photographer 1366 portfolio 6854
osteopathietexel.nlosteopathietexel.nlThe website compares the costs and quality of osteopaths in various regions of the Netherlands.Physical Therapy → Osteopathy 922 TravelContent → Maps 141 osteopath 22 cost 1990 treatment 21203 Pijnacker-Nootdorp → Pijnacker 788
coach-psycholoog.nlHenrike Coach & PsychologistThe website of Henrike Coach & Psychologist offers personal coaching and therapy in Friesland, specializing in EMDR and online therapy, aimed at improving balance, resilience, and discovering potential.Psychotherapy → Cognitive Behavioral Therapy 164 emdr 549 resilience 1091 problem 2214 balance 4582 therapy 7448 coach 25810 De Fryske Marren → Balk 224
fysiodemerk.nlFysiotherapiepraktijk de MerkFysiotherapiepraktijk de Merk provides physiotherapy and preventative care with the goal of improving patients’ mobility and preventing future complaints.Physiotherapy → Sports Physiotherapy 747 Body & Movement → Preventative Care 344 mobility 1264 rehabilitation 1512 prevention 1763 physiotherapy 4688 complaint 6479
notarisjoure.nlGroenewegen NotarissenThe website of Groenewegen Notarissen presents the takeover of the Harmsma Notarissen practice in Joure, continuing their role as a notary public in the Joure region and offering expert legal services to individuals and entrepreneurs.Notaries → Notary Office 82 files 290 notary 791 legal 937 Friesland → Heerenveen 2578
schipholtaxi-friesland.nlTaxibedrijf van ReekenTaxi de Jong Ee Eelde Friesland is a taxi company offering airport taxi services and taxi transfers to Schiphol and other airports in Friesland and surrounding areas.Taxi & Ride Services → Taxi 1062 Taxi & Ride Services → Airport Transportation 365 luxury 375 friesland 692 taxi 2090 rate 2606 Leeuwarden → Grou 366
yacht-power.nlYachtpower BVYachtpower is a company specializing in the supply, refit, and custom build of marine generators, propulsion systems, and air conditioning units.Engineering → Mechanical Engineering 737 Context → Transportation 39459 propulsion 15 refit 80 generators 96 engine 758 air conditioning 2178
goedkopefietskopen.nlGoedkopefietskopen.nlThe website provides an overview of affordable bicycles and facilitates comparing different suppliers.Bicycles & Wheels → Bicycles 1466 bike 1541 supplier 1725 bicycle 2838 route 3425 model 3546 price 8328 Amsterdam → East 1423
wolvehoeve.nlDe WolvehoeveDe Wolvehoeve is a pet boarding facility that provides vacation care for dogs and cats.Animal Welfare → Animal Boarding 58 TravelStyles → Traveling With Pets 20 pet boarding 16 vaccination 494 cat 1578 vacation 4234 inspection 4279 dog 5483 De Fryske Marren →  Rotsterhaule 19
bergsmajoure.nlAutobedrijf BergsmaThe website of Autobedrijf Bergsma presents the car dealership and its activities, including used cars and a Bovag workshop, and informs about the transition to a carwash and washboxes.Maintenance & Services → Car Wash 495 Fuel & Energy → Gas Stations 249 washbox 66 car dealership 142 car wash 352 used cars 894 workshop 19325 Achtkarspelen → Twijzel 38
jonkman-administratie.nlR.S. Jonkman AdministratieThe website of R.S. Jonkman Administratie offers various administrative, consultancy and advisory services targeted at startups, SMEs, individuals, and large companies.Accounting → General Accounting 939 Freelance & Independent → Freelancer Support 14 bookkeeper 80 customer base 171 consulting 3639 account 5781 De Fryske Marren → Sint Nicolaasga 146
regiovastgoedmakelaars.nlRegio VastgoedmakelaarsRegio Vastgoedmakelaars is a real estate brokerage firm offering services for the sale, rental, and management of real estate.Real Estate → Property Valuation & Appraisal 2123 Real Estate → Property Agents & Brokers 1366 inspection 4279 sale 5930 insurance 6359 rental 7257 property 7406 Utrecht → Amersfoort 8011
volkstuinjoure.nlVolkstuinvereniging Voor Nut en OntspanningThe volkstuinjoure.nl website promotes gardening in Joure by offering plots for rent in community gardens and private gardens, providing information and rules for gardening.Community Gardens → Garden Associations 36 Gardening → Allotments 115 food bank 216 plot 1051 garden 13129 event 45199
groepsaccommodatie-friesland.nlGroepsaccommodatie FrieslandThe website provides information and online booking options for group accommodations in Friesland.Accommodation → Group Accommodation 844 Nature → Natural Areas 257 hot tub 260 site 422 outing 982 sauna 1175 accommodation 4921 family 6462 Southwest-Friesland → Sneek 1921
vuurwerk-outlet.nlVuurwerk OutletVuurwerk Outlet is a company that sells fireworks at outlet prices.Party Supplies → Fireworks 258 outlet 235 fireworks 413 store 3901 assortment 7799 price 8328 Pijnacker-Nootdorp → Pijnacker 788
gerardjouwhypotheekadviseur.nlGerard jouw HypotheekadviseurThe website provides independent mortgage advice to individuals and entrepreneurs in the Heerenveen area.Financial Services → Entrepreneur Advice 62 bank 374 plan 2566 mortgage 4564 property 7406 Heerenveen → Akkrum 246
hartjemokum.nlhartjemokum.nlThe website Hartje Jolijt is an online collection of stories, poems, and historical information related to the personalities of Aafje Heynis and Majoor Bosshardt, and the history of ‘heartjes’ – small, flavorful drinks with unique names – produced in Amsterdam and surrounding areas, with a focus on the nostalgic atmosphere of the Golden Age and life on the Wallen.Dutch History → Golden Age 16 National Identity → Dutch Culture 57 poem 1014 recipe 5142 story 8285 North-Holland → Amsterdam 41253
willemwierda.nlWillem WierdaWillem Wierda is a specialist in the supply of verandas, sunrooms and carports.Outdoor Living → Verandas 497 verasol 14 sunroom 96 carport 248 shading 364 veranda 1055 Noordoostpolder → Emmeloord 1649
webshop-sarifairfashion.nlSari Fair FashionThis website is the online webshop of sari fair fashion, a store specializing in fair fashion, sustainable clothing, and accessories with locations in Dalfsen and Joure.Fashion → Clothing 8067 Context 161394 store 3901 clothing 9443 accessories 12975 Overijssel → Dalfsen 1099
atelier007.nlAtelier 007Atelier 007 is an architecture firm specializing in new construction projects, renovations, and the design of extensions, primarily for private clients.Project & Custom Work → Furniture Design 26 Renovation → Extensions 651 sketch 271 new construction 2672 renovation 13849 design 27202 Hof van Twente → Diepenheim 200
zoutpoel.nlWaterpark de ZoutpoelThe Waterpark de Zoutpoel is a waterpark located in Friesland that provides information about its location, history, and facilities, and allows for contact.Neighborhood Organizations → Residents’ Associations 965 Water Sports → Water 2963 sneekermeer 14 waterpark 55 harbor 691 vve 748 plot 1051 Heerenveen → Akkrum 246
bedandbreakfastjoure.nlRocket Data (Joure)The website offers a bed & breakfast for sale in Joure, located in a unique and historic building.Providers → Domain Names 1466 Places → Towns 380 bed and breakfast 305 domain 1811 sale 5930
hessinggoud.nlhessinggoudThe website compares the costs of goldsmith specialists in various regions of the Netherlands.Precious Metals → Gold 174 goldsmith 224 gold 805 cost 1990 region 5412 Sittard-Geleen → Munstergeleen 66
harmvandermolen.nlVan der Molen Bouw en OnderhoudVan der Molen Bouw en Onderhoud is a construction company located in Joure, Friesland, offering various construction and maintenance services.Construction Companies → Regional Construction Companies 152 construction company 824 skylight 966 extension 1941 window 2030 relationship 4205 floor 4781
regentmakelaars.nlRegent MakelaarsRegent Makelaars is a real estate agency located in Heerenveen that provides services for the purchase, sale, and rental of properties, as well as property management.Real Estate → Immobilien 284 agent 1253 purchase 2212 sale 5930 rental 7257 home 7976 Het Hogeland → Noordwolde 152
bouwcollectiefsneek.nlBouwCollectief Sneek bvBouwCollectief Sneek is a construction company that guides various building projects, from design to completion, for individuals, utilities, and businesses.Energy → Oil 114 Sustainable Building → Construction Projects 823 completion 126 specialist 938 partner 4272 construction 7421 design 27202 Southwest-Friesland → Oosthem 14
mynextdestination.nlRTL4The website ‘My Next Destination’ provides an overview of travels and travel destinations featured in the RTL4 television program. The program presents various types of trips, from day trips to multi-day vacations, and highlights the diverse facets of travel.Regions → Europe 6764 camp 2466 destination 2580 travel 7210 Westerwolde → Bourtange 85
fryslanbezorgd.nlN/AThe website, ‘Iten bestelle yn Fryslân,’ is a directory of restaurants in Friesland that offer delivery or take-away orders. It provides an overview of various eateries within the region.Fast Food → Döner 238 doner 131 kapsalon 509 sandwich 4098 pizza 4158 restaurant 11215 Achtkarspelen → Surhuisterveen 281
jobz-on.nlJobz-OnJobz-On is a recruitment agency based in Sneek, connecting job seekers and employers and offering various services, including staffing, temporary placement and career counseling.Context 161394 agency 944 employer 2383 job 2795 vacancy 6598 Southwest-Friesland → Sneek 1921
hondentrainingscentrumfriesland.nlHondentrainingscentrum FrieslandThe website of Hondentrainingscentrum Friesland offers courses, puppy courses, agility training, and dog walking services in the Friesland region.Dogs → Dog Activities 60 agility 170 trainer 1966 instructor 3126 dog 5483 therapy 7448 course 14728 Het Hogeland → Rottum 38
twafjilden.nlOBS De Twa Fjilden / AmbionOBS De Twa Fjilden is a school focused on creating a healthy and peaceful learning environment, with physical and mental health as a foundation.Primary Education → Islamic Schools 115 health 6366 student 7623 school 7856 education 13471 Friesland → Heerenveen 2578
dierenartsenjoure.nlDierenkliniek IepensteinDierenkliniek Iepenstein Joure is a veterinary clinic offering a range of services for pets and horses.Hospital & Acute Services → Hospitals 735 Veterinarians → Veterinary Clinics 419 veterinary clinic 63 vaccination 494 pet 1617 horse 4337
verkeersschooljanniekooystra.nlVerkeersschool Jannie KooystraVerkeersschool Jannie Kooystra offers driving lessons and theory courses in the Sint Nicolaasga area, including Idskenhuizen, Langweer, Tjerkgaast, and Joure.Driving & Lessons → Vehicles 541 cbr 172 driving school 696 driver's license 1283 driving lessons 2453 instructor 3126 De Fryske Marren → Sint Nicolaasga 146
verkeersschoolapex.nlVerkeersschool ApexVerkeersschool Apex is a driving school located in Joure.Driving & Vehicle → Vehicle License 62 lesson package 248 theory 956 driving lessons 2453 instructor 3126 practice 9089
lowvoltageink.nlLow Voltage InkLow Voltage Ink is a tattoo and piercing studio that offers a variety of services, including tattoos, permanent makeup, scar camouflage, micro hair pigmentation, piercings, and tattoo removal.Art Forms → Tattoos 381 micro hair pigmentation 19 piercing 157 permanent makeup 702 tattoo 799 appointment 13510 De Fryske Marren → Oudehaske 49
sjipko.nlSjipkoThe website of Sjipko presents handcrafted cosmetics, primarily soap and shampoo bars, made from cow's milk and natural ingredients. The company emphasizes sustainability through the use of paper packaging and the origin of the milk from Friesland.Local Events → Markets 1097 Cosmetics & Skincare → Cosmetics 1122 shampoo bar 28 natural ingredients 84 soap 231 market 2772 package 6112 Southwest-Friesland → Makkum 229
potmaaccountants.nlPotma AccountantsPotma Accountants is a full-service accounting firm that advises and supports businesses and individuals.Government & Legal → Tax 1322 Finance & Insurance → SMEs 433 business transfer 48 zzp 121 accounting firm 250 payroll administration 979 tax advice 1522 account 5781
itnoard75.nlIt Noard 75 – Makelaardij HoekstraThe website of It Noard 75 – Makelaardij Hoekstra presents a traditional farmhouse dating back to 1915 located in Broek, Friesland, Netherlands, providing details about the property’s characteristics, location, and potential uses.Apartment Living → For Sale 1007 Accommodation → Holiday Homes 727 waterway 120 living space 244 farmhouse 878 plot 1051 De Fryske Marren → Broek 21
robdevlieger.nlRob de VliegerThis website is a platform providing information about horse racing, particularly short distances, recent race results, news, and an archive.Apparel → Equestrian 2319 race 1043 results 3954 horse 4337 video 6714 photo 7778 news 15293 Wassenaar → Duindigt 15
diamondsound.nlDiamond SoundThe website of Diamond Sound is an audiovisual company based in Friesland, offering a range of services including event production, corporate presentations, congresses, and the rental of audiovisual equipment.Event Planning → Sound 339 Technology → Audiovisual & Media 688 sound 1649 presentation 1785 image 2605 equipment 4143 light 5148 event 45199
web-sitebouw.nlWEB-SitebouwThe website of WEB-Sitebouw offers custom website solutions for businesses, focusing on professional design, rapid development, reliable hosting, and search engine optimization.Web Hosting → Managed WordPress Hosting 89 hosting 3125 wordpress 3551 portfolio 6854 webshop 8648 design 27202
veenstraklussen.nlKlus- en onderhoudsbedrijf VeenstraKlus- en onderhoudsbedrijf Veenstra is a construction company offering various building-related services.Roofing → Skylights 471 Construction Companies → Finishing Contractors 383 skylight 966 carpentry 2218 frames 2556 restoration 3417 renovation 13849 maintenance 20093 Westerkwartier → Oostwold 67
oktoberfest-joure.nlOktoberfest JoureThe website provides information about the Oktoberfest Joure, a yearly event that will return to Joure in 2025 on the Merk.Festivals → Beer Festivals 175 Festivals → German 17 oktoberfest 74 ticket 2785 music 13170 event 45199
septictankbeton.nlSeptictankbeton.nlThe website of Septictankbeton.nl sells concrete septic tanks of various sizes and offers expert advice and delivery throughout the Netherlands.Installation & Fixings → Installation Materials 247 Environmental Services → Water Treatment 265 septic tank 27 capacity 282 concrete 973
focusoporde.nlChrista de BosThe website offers decluttering and Feng Shui services aimed at creating order, peace, and positive energy in the home.Home → Decluttering 161 feng shui 63 decluttering 197 overview 329 home 7976 energy 9075
copyshop-overzicht.nlCopyshop OverzichtThe website provides an overview of Copyshops (copy shops) in the Netherlands, including opening hours and prices.Directories → Websites 3473 Design & Creative → Graphic Services 1003 thesis 228 opening hours 2953 price 8328 Beekdaelen → Nuth 223
weidseblik.nlWeidse BlikThe website ‘Weidse Blik’ offers sales and advisory services related to feed for ruminants and related agricultural products and services.Livestock → Animal Husbandry 1106 Fruit & Orchard Management → Crop Production 123 grazing 57 grass 238 fertilizer 298 feed 672
heerenveen-verstopping.nlRiool Service SchaapRioolservice Heerenveen provides drain cleaning, blockage removal, and drain inspection services in and around Heerenveen.Plumbing → Drain Cleaning 745 drain cleaning 63 drain 886 blockage 965 inspection 4279 Friesland → Heerenveen 2578
booiboats.nlBooi BoatsThe Booi Boats website offers motorboats for sale and rent, specializing in providing a wide selection of new boats and affordable rental options.Automotive → Sales 1205 Marine & Watercraft → Yachts 189 motorboat 128 fleet 1351 trailer 1624 boat 2980 warranty 4701 rental 7257
ingenieursburoprompt.nlIngenieursburo PromptIngenieursburo Prompt offers software solutions to optimize bakeries, from retail to production.Software → Productivity & Office 1203 Food & Beverage → Food Industry 835 cash system 69 bakery 718 office 2898 production 4582 software 8291 Meierijstad → Veghel 1288
hanotex.nlHanotex International BVThe website of Hanotex International BV presents the company as an innovative supplier of technical textiles (non-wovens) and custom solutions for various industries, with a focus on quality and sustainability.Commerce → Wholesale 1855 filtration 60 crop protection 65 custom solution 179
kap-zones.nlKap-zones by BarbaraKap-zones by Barbara is a hair salon in Joure offering hairstyling and makeup services.Weddings → Bridal Styling 154 Makeup → Makeup Artists 733 hairstyling 482 hair salon 717 hairstyle 812 makeup 1477 atmosphere 5591
assurantiekantoor.nlAssurantiekantoor.nlThis website provides an overview of insurance agencies and insurance offices in the Netherlands.Services → Travel Insurance 99 Insurance & Risk → Insurance Brokerage 244 add 20 overview 329 province 518 Heerenveen → Hoornsterzwaag 36
sijkevandermeer.nlAtelier FantasijkeAtelier Fantasijke in Joure offers painting lessons and workshops for all levels, from beginners to advanced, focusing on various painting techniques and creating your own artwork.Painting → Acrylic Painting 547 Painting → Painting Courses 144 oil paint 202 watercolor 369 student 7623 paint 8747 workshop 19325 De Fryske Marren → Balk 224
visserendegraef.nlVisser en de Graef CommunicatieVisser en de Graef Communicatie is a communication agency with a long history in photography, design, and strategic advice.Advertising → Outdoor Advertising 254 campaign 3428 strategy 9379 photography 9503 brand 17737 design 27202 Friesland → Leeuwarden 6068
loodgieterjoure.nlLoodgieter JoureLoodgieter Joure provides 24/7 plumbing services in Joure, focusing on urgent repairs and transparent pricing.Maintenance & Repair → Plumbers 879 plumber 1210 price 8328 repair 14576
veldman-vlees.nlSlagerij VeldmanSlagerij Veldman is a butcher shop located in Joure, Friesland, specializing in the sale of artisanal and honest meat, including sausages, beef, pork, and chicken, with a particular focus on the Kesburger hamburger.Supermarkets & Grocery → Butchers 747 sausage 256 spices 340 buffet 1747 meat 2055 snack 2916
joureserolluikenendeurenspecialist.nlJourese Rolluiken en DeurenspecialistThe website of ‘Jourese Rolluiken and Doors Specialist’ is a company that repairs roller shutters and overhead doors 24 hours a day in the Joure region and surrounding areas.Windows → Roller Shutters 47 Repair → Window Repair 18 overhead door 107 roller shutters 138 repair 14576 brand 17737
artcenterjoure.nlArt Center JoureArt Center Joure is a center that combines art, freedom, energy, inspiration, and personal development for all ages.Handmade Jewelry → Jewelry Workshop 20 atelier 1417 yoga 3704 art 3856 shop 6483 workshop 19325 coach 25810
affrecruitment.nlAFF Recruitment & Executive SearchAFF Recruitment & Executive Search is a recruitment agency specializing in matching professionals with companies, particularly in the agrifood sector, and offers both standard recruitment and executive search services.HR Services → Executive Search 737 executive search 122 candidate 1896 recruitment 2015 vacancy 6598 North-Brabant → Boxtel 1154
scheepsmotoren-gebroedersdejong.nlGebr. De Jong B.V.The website of Gebr. De Jong BV provides motor repair and maintenance services for various applications, including marine and industrial engines.Maritime → Shipbuilding 568 Engineering → Mechanical Engineering 737 generatorsets 15 marine 50 engine 758 industry 1780 part 5044
taxikuiper.nlTaxi KuiperThe website of Taxi Kuiper is an online platform presenting the services of a taxi company based in Sneek, Friesland, focused on passenger transport for various purposes, including business travel, airport transfers, and contract transportation.Taxi & Ride Services → Taxi 1062 Specialized Transport → Business Transportation 231 business transportation 13 airport transportation 28 chauffeur 452 taxi 2090 transportation 2851 Southwest-Friesland → Sneek 1921
kattenpensiondezwartekat.nlKattenpension De Zwarte KatKattenpension De Zwarte Kat offers accommodation for cats in a peaceful location in Friesland.Accommodation → Pet Hotels 89 Animal Care → Cat Care 132 litter box 40 cat food 98 cat 1578 pension 1682 room 3411
romyvanderwieluitvaartzorg.nlRomy van der Wiel UitvaartzorgRomy van der Wiel Uitvaartzorg is a funeral service provider based in Friesland that offers a range of services, including crematories, cemeteries and sustainable funerals.Death → Funerals 552 funeral service 127 cemetery 395 funeral 2477 wishes 2717 family 6462 Leeuwarden → Grou 366
fotos-by-hannie.nlFOTO'S BY HANNIEThe FOTO'S BY HANNIE website showcases a collection of self-created photographs, primarily focusing on nature, cities, animals, flowers, and various other subjects.Nature & Landscape → Nature Photography 482 city 1875 animal 2908 flowers 3248 exhibition 5332 photo 7778 nature 9094 Waadhoeke → Dronryp 116
fysiotherapie-skipsleat.nlFysiotherapie SkipsleatFysiotherapie Skipsleat provides physiotherapy treatments in the Skipsleat neighborhood of Joure, focusing on personalized attention and the use of various therapies.Respiratory Diseases → Asthma 27 Alternative Medicine → Ayurveda 281 treatment plan 380 breathing 976 yoga 3704 physiotherapy 4688 complaint 6479 treatment 21203
h4omakelaardij.nlH4O MakelaardijThe website of H4O Makelaardij presents real estate listings for sale and rent, and offers valuation services in the Zuidwest and Midden-Friesland region.Real Estate & Investment → Intangible Assets 123 listings 525 valuation 2697 property 7406 De Fryske Marren → Lemmer 1188
echocentrumannekeschmidt.nlEchocentrum Anneke SchmidtEchocentrum Anneke Schmidt is a center in Joure specializing in medical ultrasounds and pregnancy care.Prenatal Care → Ultrasound 187 Pregnancy & Childbirth → Midwifery 619 echo 34 midwife 553 ultrasound 769 baby 1895 pregnancy 2739
technisi.nlTechnisiTechnisi is a technical staffing agency based in Northern Netherlands, connecting technical professionals with clients.Online Services → Job Boards 1036 Employment & Labor → Employers 608 specialist 938 agency 944 career 2513 vacancy 6598 technology 6816 Smallingerland → Drachten 2052
boatworldxl.nlBoatWorldXLBoatWorldXL is a specialist retailer of boats, tenders, and outboard motors, offering a wide selection of new and used boats, as well as service and storage options. The website provides an overview of available boats, information on boat rental and storage, and the company's contact details.Boats → Sloops 129 Marine & Watercraft → Watercraft 44 outboard motor 63 tender 329 boat 2980 rental 7257
taxirichardsneek.nlTaxi Richard SneekThe website of Taxi Sneek Richard presents a taxi company offering services in the Sneek region and surrounding areas, including transportation to and from Schiphol and various special transportation options.Taxi & Ride Services → Taxi 1062 Services → Personal Services 1062 ride 1075 taxi 2090 transportation 2851 region 5412 Southwest-Friesland → Bolsward 566
fysiotherapie-visser.nlFysiotherapie VisserFysiotherapie Visser in Joure offers physiotherapy treatments with a focus on identifying the cause of complaints and providing personalized guidance.Spa → Wellness Centers 238 therapist 1890 facility 2616 physiotherapy 4688 complaint 6479 treatment 21203
zeetsiis-joure.nlZee TsiisDelicatessenwinkel Zee Tsiis in Joure offers a variety of delicacies, beverages, and gifts, emphasizing regional products from Friesland.Gifts → Gift Sets 200 Dairy & Cheese → Specialty Food Stores 64 regional products 391 nuts 417 tapas 465 cheese 1205 meat 2055 gift 6442
captaintractors.nlNoordmachines B.V.The website of Captain Tractors presents and sells compact / mini tractors equipped with Stage 5 Mitsubishi diesel engines, focusing on sustainability, reliability, and an attractive design.Machinery & Repair → Machinery 1045 Machinery & Repair → Tractors 266 dealer 757 engine 758 tractor 789 model 3546 finance 5341 maintenance 20093 Neder-Betuwe → Dalwagenseweg 219
friesland-buitenspeelgoed.nlFriesland BuitenspeelgoedThe Friesland Buitenspeelgoed website is an online store selling various outdoor play equipment, including trampolines, scooters, play structures, and accessories, aimed at families and children.Games & Puzzles → Toy Stores 347 play structure 48 trampoline 169 scooter 1236 showroom 4883 accessories 12975 Smallingerland → Drachten 2052
podozorg-joure.nlPodozorg JourePodozorg Joure is a practice in Joure offering podological care, including custom orthotics and treatment of foot complaints.Orthopedics → Foot Problems 977 Repair → Shoe Repair 179 foot complaints 34 podologist 63 shoe repair 110 orthotics 172
yvonnekerkhof.nlYvonne Kerkhof + PartnersYvonne Kerkhof + Partners provides personal and professional development services to individuals and businesses, focusing on career coaching and professional identity development.Career → Career Development 1070 identity 1028 career 2513 coach 25810 training 28133 Netherlands → Groningen 23734
werkenbijdk.nlDK Accountants & AdviseursThe website, Werkenbij DK, is a job board that recruits professionals to DK Accountants & Adviseurs and presents the opportunities for professional development within the company.Business Support & Advisory → Advisory 413 Finance & Accounting → Accounting 3092 challenge 1697 growth 4054 vacancy 6598 Medemblik → Zwaagdijk-Oost 124
dejongjoure.nlBV. S. de Jong & Zn.The website of BV. S. de Jong & Zn. provides information about the company, its history and current activities, particularly the sale of propane gas.Manufacturing & Industrial → Industrial Services 400 Agriculture → Agricultural Machinery & Equipment 631 technical service 72
awerk.nlAwerk uitzendbureauAwerk uitzendbureau is a recruitment agency that connects job seekers and employers in Northern Netherlands.Recruitment → Personnel Services 162 Staffing & Recruitment → Temporary Staffing 1003 temporary staffing 79 employer 2383 job 2795 match 3471 vacancy 6598 Utrecht → South 328
stefspanhaak.nlStef Spanhaak TrappenspecialistThe website of Stef Spanhaak Trappenspecialist from Joure showcases custom-made stairs, ranging from modern to classic designs, and informs visitors about the work, experience, and contact options of the stairmaker.Construction & Renovation → Staircases 329 Construction & Renovation → Stairs 110 stair 815 wood 4153 design 27202
gordeco.nlGordeco GordijnatelierThe website of Gordeco Gordijnenatelier provides information about the company, its target audiences, and the products it offers, with a focus on custom-made curtains and exclusive fabrics.Interior → Curtains 831 Home → Decor & Furnishings 5819 custom-made 176 cushion 823 curtains 1015
borstvoedingsadviezen.nlBoezemvriendjesBoezemvriendjes is a website that offers products and support for breastfeeding, with a focus on solving problems and facilitating milk production.Pediatric & Child Health → Breastfeeding 212 Children → Baby 1069 breast pump 56 breastfeeding 398 De Fryske Marren → Lemmer 1188
chinatown-joure.nlChinatown JoureThe Chinatown Joure website provides an online ordering system for Chinese food and drinks, with the option to pick up orders on-site. The goal is to offer customers an easy way to order Chinese meals and enjoy them.Asian → Chinese 415 spring rolls 141 points 612 buffet 1747 dish 5936 order 6912 menu 13856
kraamzorgstellingwerven.nlKraamzorg StellingwervenKraamzorg Stellingwerven is a collaboration of experienced postpartum care providers offering care in Weststellingwerf and surrounding areas.Family → Motherhood 255 Pregnancy & Childbirth → Postpartum Care 658 postpartum care provider 18 family life 32 postpartum care 236 breastfeeding 398 childbirth 894 parent 4318 Ooststellingwerf → Appelscha 331
altenburgfunderingstechniek.nlAltenburg FunderingstechniekThe website of Altenburg Funderingstechniek presents a complete solution for foundation work, with a focus on the use of mortelscrew piles and sustainable practices.Construction Technology → Foundation Technology 135 Building & Construction → Sustainable Building 1004 production process 168 foundation 6678 sustainability 18451 Southwest-Friesland → Arum 37
gdsolar.nlGD SolarThe website of GD Solar provides information about solar panels and PV systems, focusing on supply, installation, and advice.Audio → Components 489 Environment → Energy Solutions 255 pv system 11 inverter 313 solar panels 4701 Steenwijkerland → Belt-Schutsloot 29
bouwbedrijfhoogland-zn.nlBouwbedrijf Hoogland & ZnBouwbedrijf Hoogland & Zn is a construction company specializing in small-scale home maintenance and the installation of windows and Velux skylights.Windows & Doors → Windows 2999 Customer Service → Quotes 209 address 901 skylight 966 window 2030 portfolio 6854 repair 14576 maintenance 20093
bmhmotoren.nlBMH MotorenBMH Motoren is a specialist in the sale and trade-in of Triumph motorcycles, particularly twin-cylinder models.Classic Cars → British Cars 41 Cars → Brand 579 triumph 18 motorcycle 2110 part 5044
ansichtkaartenhuis.nlAnsichtkaartenhuis BVThe Ansichtkaartenhuis website offers a unique collection of postcards and sets, targeting collectors and enthusiasts.Collections & Antiques → Collections 177 Events → Postcards 56 collector 157 postcard 278 Het Hogeland → Leens 104
meergevel.nlMeergevelThe website of Meergevel offers facade renovation, facade cleaning, and restoration services with over 25 years of experience.Maintenance & Services → Facade Maintenance 673 Masonry & Plastering → Masonry 576 chimney renovation 13 jointing 17 facade restoration 18 facade renovation 130 facade cleaning 385
seniorenbond.nlSeniorenbond PancratiusSeniorenbond Pancratius is a social and sporty association for seniors and older adults in Oosterblokker.Social Organization → Senior Organizations 750 Recreation → Senior Activities 244 soos 40 outing 982 museum 2002 association 8562 Hoorn → Blokker 130
huismansprinklertechniek.nlHuisman SprinklertechniekThe website of Huisman Sprinklertechniek is dedicated to informing visitors about and offering residential sprinkler systems as a means of enhancing fire safety in homes and vacation homes.Safety → Fire Safety 1048 Building Systems & Services → Mechanical Installation 80 water pipe 118 fire safety 589 installation 13742
huismaninstallatieprofessionals.nlHuisman InstallatieprofessionalsHuisman Installatieprofessionals provides a wide range of installation services for new construction, renovations, and complex projects.Energy → Energy Saving 1151 Installation & Repair → General Installation 727 smart home 439 heat pump 2541 installation 13742
zeilmakerijjoure.nlZeilmakerij JoureZeilmakerij Joure is a company specializing in the design and production of high-quality, custom sail solutions and other applications.Water Sports → Sailing 1501 Transportation → Marine & Watercraft 2309 balloon 554 sail 965 industry 1780 water 2501
decranberry.nlDe CranberryDe Cranberry is a delivery service for potatoes, vegetables, and fruit in the Heeg region.Food Delivery → Delivery 2227 Retail & Commerce → Commerce 8244 day 189 delivery service 236 potato 542 fruit 1166 vegetables 1416 store 3901 Southwest-Friesland → Heeg 227
roelevinksport.nlRoelevink Sport VOFThe Roelevink Sport website offers judo classes for all ages, focusing on developing self-confidence, self-defense, strength, fitness, and resilience.Martial Art → Judo 389 motor skills 112 judo 375 strength 789 resilience 1091 self-confidence 1173 De Fryske Marren → Lemmer 1188
beautybrowsbymargriet.nlBeauty&Brows by MargrietThe website of Beauty&Brows by Margriet offers information about various cosmetic treatments for the face and eyebrows, performed by Margriet.Eyelash Services → Eyebrows 777 henna 74 eyebrows 1127 facial treatment 1152 salon 5541 treatment 21203
directbeeld.nlLoodzwaar Media / DirectBeeld.nlThe website Direct Beeld specializes in live streaming and photo streaming of webcams and timelapse images, particularly for construction projects and events.Online Entertainment → Webcam Sites 14 Music → Streaming 170 timelapse 32 webcam 236 stream 684 photo 7778
wierdagroep.nlWierda GroepWierda Groep is a company that provides custom solutions for trucks, including sales, maintenance, repair, design, and construction.Auto Parts & Tires → Vehicle Parts 205 Maintenance & Services → Truck Maintenance 69 truck 1412 vehicle 3743 vacancy 6598 Smallingerland → Drachten 2052
sjuustjoure.nlSjuustSjuust Official Webshop is an online store selling gemstones, minerals, interior accessories, jewelry, and fashion accessories.Jewelry → Gemstones 451 Hobbies → Mineralogy 15 minerals 311 gemstone 856 shopping cart 1521 accessories 12975
spw-media.nlSpw-MediaThis website provides information and media related to motorsport, specifically events, photos, and videos of the KNMV and VTBM.Associations → Sports Associations 1082 Motor → Motorsport 1438 rider 594 calendar 1556 video 6714 photo 7778 event 45199 Het Hogeland → Uithuizen 187
tpblaauwhof.nlTandartspraktijk BlaauwhofTandartspraktijk Blaauwhof in Joure provides dental care to patients of all ages.Local Communities → Villages 1005 teeth 680 patient 4082 practice 9089 treatment 21203
praktijkinjeelement.nlPraktijk In Je Element Nienke van der GrijnShiatsu practice ‘In je Element’ in Joure offers shiatsu and reflexology treatments for various ailments and health issues.Alternative Medicine → Energy Medicine 988 Alternative Medicine → Shiatsu 830 headache 182 shiatsu 578 balance 4582 energy 9075
schilderwerken-kdejong.nlK. de Jong SchilderwerkenK. de Jong Schilderwerken provides painting and wallpapering services, including advice, for homes in Joure and surrounding areas.Maintenance & Services → Facade Maintenance 673 woodwork 387 wall 1378 facade 1490 paint 8747 renovation 13849
headroom-joure.nlHeadroomHeadroom barber shop in Joure offers hairdressing services including cutting, coloring, and the sale of products.Men’s Grooming → Barbershops 1012 Wellness → Stylists 244 barbershop 512 cut 926 coffee 3838 music 13170
metselbedrijfduan.nlMetselbedrijf Duan b.V.The website of Metselbedrijf Duan presents the company as a masonry contractor offering complete masonry packages, including plastering, scaffolding and pointing, and executing projects for various clients.Masonry & Plastering → Masonry 576 masonry 460 scaffolding 519 crane 662 plaster 2175 De Fryske Marren → Balk 224
stichtingmilou.nlStichting MilouThe Stichting Milou aims to enhance the life of Milou using all available means.Sports Clubs → Gymnastics 481 trampoline jumping 12 foundation 6678 photo 7778
buitensex-locaties.nlbuitensex-locaties.nlThe website provides locations in the Netherlands where discreet sexual encounters in nature are possible.Crime & Safety → Crime 356 Law → Criminal Law 1803 webcamsex 12 parking lot 75 Northeast-Friesland → Dokkum 846
schildersbedrijfkampen.nlSchildersbedrijf KampenSchildersbedrijf Kampen is a painting company that serves both private and commercial clients and specializes in painting, wall coverings, and glass service.Windows → Glazier 440 Finishing & Trades → Building Trades 112 glass service 19 wall coverings 60 color consultation 100 paint 8747 renovation 13849 De Fryske Marren → Sint Nicolaasga 146
hovenierhollaar.nlHoveniersbedrijf HollaarHoveniersbedrijf Hollaar is a landscaping company that offers a range of garden maintenance services, from design and installation to maintenance and renovation.Outdoor & Garden → Garden Businesses 108 garden 13129 installation 13742 maintenance 20093 design 27202 Friesland → Heerenveen 2578
kuperusheeringa.nlKuperus Heeringa MakelaardijKuperus Heeringa Makelaardij presents various homes and estates for sale in the Sneek, IJlst, Heeg and surrounding area.House Types → Houses 2546 Property Valuation & Appraisal → Regional Real Estate Agents 454 canal 507 farmhouse 878 plot 1051 house 8121 garden 13129 Southwest-Friesland → Heeg 227
ag-joure.nlAdministratiekantoor GerlsmaAG Joure is an accounting firm providing administrative and tax advisory services to both private and business clients.Accounting → Business Accounting 688 Company & Business → Individuals 827 tax 2100 administration 6587
freulefroukje.nlFreule Froukje JoureThe website of Bed and Breakfast Freule Froukje in Joure presents the accommodation and provides information about rooms, rates, photos, the surrounding area, and contact details.Water Travel → Boat Tours 640 Nature → National Parks 898 boat trip 184 friesland 692 wifi 1372 breakfast 1822 room 3411 garden 13129
salaattijden.nlSalaat TijdenThe website provides Islamic prayer times for various cities in the Netherlands.Religion → Islam 542 News & Journalism → Regional News 948 prayer 397 time 932 city 1875 region 5412 Velsen → Velsen-Zuid 121
faberjoure.nlFaber Joure B.V.Faber Joure B.V. provides industrial service and transport services, including the transport, assembly, and disassembly of machinery and production lines.Logistics & Transport → Logistics 7444 Context → Transportation 39459 production line 124 machinery 519 crane 662 assembly 1733 transport 6105 Schagen → Petten 106
passend-interieur.nlPassend InterieurPassend Interieur is an interior construction company that designs, produces, and installs custom interiors for both business and private clients.Finishing & Trades → Interior Construction 502 production 4582 interior 8093 installation 13742 design 27202
sip-jantuin.nlSip-jan Tuin & OnderhoudSip-jan Tuin & Onderhoud is a TuinKeur-certified landscaping company offering services for garden design, maintenance, and related tasks.Garden Maintenance → Gardeners 685 Green Spaces → Green Maintenance 449 soil 930 fence 1814 tree 1879 garden 13129 maintenance 20093 design 27202 Southwest-Friesland → Sneek 1921
demannenkapperjoure.nlDe Mannenkapper JoureThe website of De Mannenkapper Joure offers barbering services for men in Joure, with a focus on honesty and familiarity.Men’s Grooming → Barbershops 1012 Beauty → Cosmetic Procedures 1147 barber 418 beard 468 haircut 1158 appointment 13510
praktijkoudehaske.nlHousecall Practice OudehaskeThe website of Housecall Practice Oudehaske provides information about the practice, appointments, staff, and digital facilities for patients.Ambulatory & House Calls → House Calls 46 blood test 200 doctor 1397 practice 9089 care 12338 appointment 13510 De Fryske Marren → Oudehaske 49
overall-design.nlOverall Design Projects BVOverall Design Projects BV is a full-service agency specializing in the design and execution of trade show booths and interior projects, with a focus on European and American markets.Event Management → Event Marketing 496 trade show booth 10 planning 1969 concept 3338 production 4582 transport 6105 interior 8093 Friesland → Leeuwarden 6068
ludze-uitvaartzorg.nlLudze UitvaartzorgLudze Uitvaartzorg is a funeral services provider that offers personalized and flexible services to families following the loss of a loved one.Death → Funerals 552 Legal → Legal Issues 56 bereaved 291 approach 971 farewell 1109 funeral 2477
mecanorth.nlMeca NorthThe website of Meca North offers various industrial services, including machine construction, maintenance, repair, the deployment of freelancers (ZZP), and project management, with a focus on sustainable partnerships and high-quality solutions.Industrial Equipment & Services → Machine Building 665 Maintenance & Services → Machine Maintenance 262 machine construction 146 freelancer 877 project management 3423 repair 14576 maintenance 20093
pleinjoure.nlPlein JoureThe Plein Joure website serves as an informative resource for parents, students, and visitors, providing details about the school’s education, activities, contact information, and registration process.Primary Education → Public Education 424 Curriculum & Resources → Educational Information 33 leave 84 introduction 277 fee 640 schedule 2624 education 13471
rebruck.nlMeubel restylen & woonaccessoires Joure - RebrûckThe website offers furniture restyling and home accessories, reusing old furniture and combining it with new items.Interior Design → Interior Consulting 615 Repair → Furniture Repair 259 restyle 97 color 4159 paint 8747 furniture 8751 accessories 12975
solexclubaow.nlSolexclub AOWThe Solexclub AOW is a Dutch club that organizes tours and shares solex experiences with enthusiasts.Planning → Tours 870 solex 61 tours 1048 club 4225 member 10154
slapeninoudehaske.nlMini-Camper Camping - OudehaskeThe website of Mini-Camper Camping - Oudehaske presents a small campsite in Friesland, focused on relaxation, enjoyment of nature, and exploring the surrounding environment.Camping → Campsites Netherlands 792 Nature → National Parks 898 pipowagen 25 caravan 1394 campsite 2093 relaxation 3968 environment 4873 nature 9094 De Fryske Marren → Oudehaske 49
opslag-follega.nlOpslag FollegaOpslag Follega is an storage company that rents storage space in Lemmer and Follega.Logistics → Storage 1170 storage unit 68 storage space 388 contract 2415 facility 2616 sustainability 18451 De Fryske Marren → Lemmer 1188
huisman-makelaars.nlJasper HuismanThe website of Jasper Huisman is a real estate agency located in Balk, Gaasterland, and South West Friesland, specializing in helping clients buy and sell homes. It provides a database of properties and home videos and a service to find dream homes.Property Advice & Guidance → Property Transactions 184 Real Estate → Property Search & Listings 506 database 1153 agent 1253 brochure 1642 property 7406 house 8121 De Fryske Marren → Balk 224
haarwerkenfriesland.nlteamharryhummelHaarwerken Friesland is a specialized salon in Friesland that offers hairpieces for people experiencing hair loss.Hair Care → Hair Extensions 282 Disease & Treatment → Conditions 174 hairpiece 153 hair loss 242 salon 5541
derkstegeman.nlDerk StegemanThe website of Derk Stegeman is a professional presentation of a cellist, teacher, and conductor offering his services to string and symphony orchestras and for musical accompaniment, choir leadership, and cello lessons.String Instruments → Cello 76 Recordings & Media → Musicians 437 cello 121 conductor 1217 orchestra 1315 teacher 2890 Southwest-Friesland → Pingjum 43
fotoclubdespil.nlFotoclub de SpilFotoclub de Spil is a photography club located in Sneek and surrounding areas, focused on sharing knowledge and experience in the field of photography.Neighborhood Organizations → Residents’ Associations 965 Arts → Imaging & Photography 7687 darkroom 16 neighborhood 2424 community 7931 photography 9503 member 10154 Southwest-Friesland → Sneek 1921
aikidofriesland.nlAikido FrieslandThe Aikido Friesland website provides information about aikido training sessions held in Joure and Heerenveen, and offers the opportunity to attend a trial class.Body & Movement → Movement 967 Martial Art → Aikido 101 aikido 148 trial class 311 self-confidence 1173 body 3490 collaboration 16036 training 28133 Friesland → Heerenveen 2578
natuurprint.nlAlbert Foekema FotografieThe website, Natuurprint.nl, showcases the nature photography portfolio of Albert Foekema, featuring landscapes, macro photography, and details of nature.Nature & Landscape → Nature Photography 482 Nature & Landscape → Landscape Photography 530 macrophotography 51 butterfly 140 flora 171 bird 922 landscape 2609 nature 9094 Southwest-Friesland → Sneek 1921
remcodijkstragoudsmederij.nlRemco Dijkstra GoldsmithThe website of Remco Dijkstra Goldsmith showcases a goldsmith in Emmeloord who designs and manufactures unique, handcrafted jewelry based on personal wishes and stories.Crafts → Goldsmithing 168 goldsmith 224 jewelry 4599 story 8285 workshop 19325 design 27202 Noordoostpolder → Emmeloord 1649
landelijkezitmeubelen.nlLandelijkeZitmeubelenLandelijkeZitmeubelen is a rural furniture store offering a wide selection of country-style furniture, accessories, and rugs.Living & Dining → Chairs 393 Living & Dining → Living Room Furniture 163 dining chair 40 armchair 201 rug 299 sofa 481 atmosphere 5591 furniture 8751 Southwest-Friesland → Workum 363
maengevelbeheer.nlMaen GevelbeheerMaen Gevelbeheer is an organization specializing in facade management and maintenance.Maintenance & Services → Facade Maintenance 673 Project Management → Construction Management 1038 assessment 1205 facade 1490 inspection 4279 maintenance 20093 design 27202 Friesland → Heerenveen 2578
haskerveldverhuur.nlHaskerveld VerhuurThe website Haskerveld Verhuur offers rental of trailers and forklifts in Joure, with the option of on-site rental and with or without a driver.Logistics & Transportation → Rental Companies 414 Trailers & Towing → Trailers 650 forklift 447 trailer 1624 transport 6105 rental 7257
copyshopjoure.nlFoto NantkoCopyshop Joure is a print and photo service in Joure, Friesland, offering various printing and copying options, including passport photos, canvas prints, and large-format printing.Image Products → Photo Printing 54 Communication & Content → Copying 77 passport photo 227 canvas 694 print 5511 video 6714 photography 9503
sloepverhuurfriesemeren.nlSloepverhuur Friese MerenThe website offers boat rentals on the Frisian lakes, with a focus on renting boats in the region around Joure and Terherne.Vacations → Water Travel 978 frisian lakes 14 sailing route 23 boat 2980 Heerenveen → Akkrum 246
platenbaas.nlPlatenbaasPlatenbaas rijplatenverhuur provides temporary hard surfaces in the form of mats and shoring for construction projects and events.Venues & Rentals → Event Rental 723 mat 249 rental 7257 construction 7421 event 45199
arjankool.nlArjan KoolThe website of Arjan Kool presents his work as a landscape designer and spatial quality advisor, with a focus on green city-rural connections.Green Spaces → Green Maintenance 449 Planning & Development → Spatial Planning 889 site 422 infrastructure 1460 landscape 2609 connection 4007 municipality 6837 West-Maas en Waal → Appeltern 113
groenjoure.nlGroen JoureThe website of Groen Joure describes the mission and projects of a local group of residents committed to a sustainable and green development of Joure and surrounding areas.Initiatives & Collaboration → Initiatives 459 Education & Youth → Local Organization 65 nature 9094 sustainability 18451 De Fryske Marren → Scharsterbrug 16
ahploegstra-kraanverhuur.nlAH Ploegstra Tuinonderhoud-loonwerk-kraanverhuurAH Ploegstra Tuinonderhoud-loonwerk-kraanverhuur is a company offering services for garden construction, landscaping, and equipment rental.Land Development & Earthworks → Earthmoving 643 Civil & Infrastructure → Earthworks 370 equipment rental 15 garden construction 86 landscaping 1529 paving 1942 certification 3380 Opsterland → Gorredijk 398
noorderlichtstudios.nlNoorderlicht Studio'sNoorderlicht Studios is a studio located in Friesland that offers both recording facilities and a rehearsal space, with a focus on professional audio recordings and a comfortable working environment.Recordings & Production → Recording Studios 473 Civil & Infrastructure → Roads 252 piano 820 view 1045 record 1098 ventilation 1110 room 3411 studio 5465 Southwest-Friesland → Sneek 1921
paradisesoul.nlParadise SoulParadise Soul Handpan studio Joure is a shop and studio that sells handpans and offers workshops and lessons.Instrument → Percussion 262 handpan 24 instrument 1295 lesson 5154 sale 5930 workshop 19325
beautysalonmoniek.nlBeautysalon MoniekThe Beautysalon Moniek website presents services and products related to natural beauty care and holistic treatments.Hair Care → Salons 1476 Cosmetics & Skincare → Cosmetics 1122 agenda 4374 salon 5541 treatment 21203
moament.nlMoament MediaThe website of Moament Media presents the services of Frank Meester, an all-round photographer and media specialist offering photography, video, and web design.Creative → Video 777 creative 539 branding 4614 video 6714 photography 9503
pixelcentrale.nlpixelcentraleThe Pixelcentrale website offers 3D impressions and visuals for various sectors, including real estate, architecture, and the SMB sector. The focus is on creating appealing and convincing images.Architecture → Architectural Visualization 40 Architecture → 3D Visualization 79 impression 160 visualization 621 logo 4660 real estate 4981
nacamateurclub.nlDutch Amateur Riders ClubThe website of the Dutch Amateur Riders Club provides news, standings, and information about events.Apparel → Equestrian 2319 equestrian 138 standings 143 facebook 850 news 15293 event 45199 Wassenaar → Duindigt 15
damwand-shop.nlProlock ShopThe Prolock Shop website is an online store and specialist in plastic dam walls, offering durable solutions for water management, infrastructure, and construction projects.Civil & Infrastructure → Hydraulic Engineering 85 Nature Conservation → Water Management 1138 dam wall 49 water management 260 durability 366
praktijkvanhuizen.nlPraktijk van HuizenThe website of Praktijk van Huizen is a physiotherapy practice located in Grou, Friesland, offering holistic therapies.Therapy → Breathing Therapy 194 Context 161394 cranio sacral therapy 25 breathing 976 sport 4228 physiotherapy 4688 Leeuwarden → Grou 366
onsliefdesfeest.nlFrederika Postma and Lieke van AsOns Liefdesfeest is a website that organizes and supports love festivals, focusing on unique and personalized celebrations.Services → Personal Services 1062 Celebratory Occasions → Wedding Events 51 ceremony 824 connection 4007 inspiration 4081 North-Holland → Alkmaar 6507
tennisschoolvanderlaan.nlTennisschool van der LaanThe Tennisschool van der Laan offers tennis lessons throughout the year at TV Joure, catering to both beginners and advanced players.Stables → Lessons 112 tennis 836 seniors 904 court 999 youth 3126 lesson 5154
modelballonteam.nlModelballon Team Midden NederlandThe website of Modelballon Team Midden Nederland presents information about model balloon demonstrations, events, and photos of their activities.Seasonal & Weather → Air Shows 10 Air Services → Aviation 444 pilot 208 demonstration 377 balloon 554 event 45199 Lingewaard → Gendt 190
weidsebliktuinendier.nlWeidse Blik Tuin & DierWeidse Blik Tuin & Dier is a shop in Joure that sells garden maintenance products and animal feed, and provides agricultural advice.E-Commerce → Pet Supplies 1013 Animals → Pets 1382 weighbridge 22 garden maintenance 462 feed 672 pet 1617 promotion 2062 horse 4337
lofderzotheidshop.nlLOF der Zotheid JoureThe website LOF der Zotheid Joure is an online store for fashion, home décor, and accessories that is temporarily closed but visitors can find information about the store, opening hours, brands and reviews from customers.Consumer → Gift Ideas 17 Context 161394 discounts 795 fashion 2212 reviews 3172 store 3901 brand 17737
adem-reis.nlAdemReisThe website offers breathwork, trauma release breathwork, and other techniques to promote inner well-being, emotional healing, and awareness.Mindfulness → Breathing Techniques 646 Mental & Emotional Well-Being → Psychotherapy 685 breathing session 35 inner 47 breathwork 318 awareness 1735 trauma 2107
multispaces.nlMultispacesThe website of Multispaces presents a range of flexible, multifunctional business spaces and storage units, emphasizing high-quality and attractive spaces in the Joure region.Logistics → Storage 1170 storage unit 68 variant 68 business space 130 flexibility 996
keizersnedelittekennazorg.nlLiesbeth HilvertsThe website offers scar care and relaxing massages, specifically focused on women after a Cesarean section in North Holland.Medical Devices → Wound Care 62 Body & Movement → Physical Health 1058 scar 142 massage 7646 treatment 21203 Oldambt → Winschoten 830
groothandelsouvenir.nlSouvenirgroothandel Hollandse souvenirsThe website is a wholesaler specializing in souvenirs, offering a wide range of products including refrigerator magnets, posters, and Zeewse knots.Specialty Shops → Souvenirs 193 Gifts & Souvenirs → Gift Items 342 knot 37 magnet 127 souvenir 175 poster 837 item 1125 jewelry 4599 Veere → Oostkapelle 205
waterlandvastgoed.nlWaterland VastgoedWaterland Vastgoed provides services for the management and rental of real estate.Rental Properties → Renting 386 Real Estate → Real Estate Rental 70 tenant 920 space 3846 real estate 4981 portfolio 6854 rental 7257 Ooststellingwerf → Oosterwolde 417
watervillaballingbuer.nlWatervilla BallingbuerWatervilla Ballingbuer is a website offering luxury holiday homes on navigable waters in the Netherlands.Accommodation → Villas 1018 Accommodation → Bungalow Parks 931 villa 1351 comfort 1473 water 2501 holiday home 2753 terrace 4847 Southwest-Friesland → Sneek 1921
klaverweidevlees.nlKlaverweide VleesThe website of Klaverweide Vlees is an online platform and market stall selling organic meat from Friesland, including delivery service and offers.Supermarkets & Grocery → Butchers 747 Food → Meat 1123 butcher 148 delivery service 236 friesland 692 market 2772 Waadhoeke → Menaam 72
iepenloftjoure.nlIepenloft Fitness JoureIepenloft Fitness Joure is an outdoor fitness location in Joure offering a variety of training programs, including bootcamp, survival training, and group activities.Conferences & Meetings → Corporate Events 2472 Human Resources → Employee Benefits 245 vitamin 469 bootcamp 497 trainer 1966 training 28133
reshapeclub.nlSportschool Reshape ClubThe website of Sportschool Reshape Club in Joure showcases the facilities, services, and promotions of the gym, aiming to encourage visitors to sign up or request a trial class.Sport Facility → Sports Centers 439 day pass 25 gym 699 personal training 1271 group classes 1306 equipment 4143
vriendenvandeflecke.nlStichting Vrienden van De FleckeStichting Vrienden van De Flecke is an organization dedicated to improving the well-being of residents and clients of De Flecke care and treatment center in Joure.Charities → Fundraising 1005 friend 639 stay 702 center 1115 resident 3245 donation 5110 foundation 6678
mariannemusic.nlMarianne MusicThe website of Marianne Music presents Marianne Groothof as a conductor, music teacher, and creative entrepreneur. The goal is to communicate her activities and services, including inspiring young people to make music, conducting orchestras, and creating portraits and live drawing events.Orchestras → Fanfare Orchestras 244 orchestra 1315 portrait 3685 studio 5465 music 13170 Heerenveen → Akkrum 246
manegespiegels.nlFOSK MirrorsManegespiegels.nl provides custom mirrors for equestrian sports, both indoors and outdoors.Lighting → Chandeliers 32 Driving & Lessons → Vehicles 541 mirror 371
notaris-overzicht.nlNotariskantoorThe website provides information on notarial services, including costs, locations, and various legal documents.Legal → Notaries 848 power of attorney 39 cohabitation agreement 44 bv 79 deed 129 transaction 613 notary 791 Het Hogeland → Leens 104
autorijlesbijgeerligs.nlAutorijschool GeerligsAutorijschool Geerligs is a driving school located in Rottum that offers driving lessons to students in the region.Transportation → Driving & Lessons 1163 driving school 696 driver's license 1283 exam 2120 driving lessons 2453 student 7623 Het Hogeland → Rottum 38
autorijopleiding-friesland.nlAutorijopleiding FrieslandAutorijopleiding Friesland provides driving lessons and training in Friesland to help people obtain a driver's license B.Driver’s License → Scooter License 102 license 1288 exam 2120 instructor 3126 lesson 5154 car 10865 course 14728 Southwest-Friesland → Workum 363
autorijschoolhhoogkamp.nlAutorijschool H. HoogkampAutorijschool H. Hoogkamp offers driving lessons in the Idskenhuizen region.Driver & Vehicle → Post-Secondary Education 40 Driving & Vehicle → Vehicle Operation 234 driving lesson 712 driver's license 1283 exam 2120 instructor 3126 region 5412 De Fryske Marren → Scharsterbrug 16
bosadvocatuur.nlBos AdvocatuurBos Advocatuur Sneek is a law firm located in Sneek that provides legal assistance and specializes in various legal areas, with a focus on solution-oriented legal work and a personal approach.Legal → Lawyers 708 legal area 293 legal assistance 537 law firm 585 De Fryske Marren → Balk 224
ecofloornoord.nlECO FLOOR NOORD B.V.The website of ECO Floor Noord presents Eco 2 Floor, a self-leveling, cement-based leveling slab made of blast furnace slag, and provides information on its benefits, installation, and offer request.Sustainable Construction → Materials 1043 transport 6105 quote 12863 installation 13742
hekwerknoord.nlHekwerk Noord BVHekwerk Noord BV is a specialist in the design, manufacturing, and installation of custom fences and access gates.Garden → Fences 824 gate 499 steel 1177 fence 1814 installation 13742 Smallingerland → Drachten 2052
hoogeboomexclusive.nlHoogeboom ExclusiveThe website Hoogeboom Exclusive showcases a collection of exclusive automobiles, primarily from German brands such as Audi, BMW, and Volkswagen, emphasizing the emotional aspect of car ownership.Journalistic Visuals → Photojournalism 85 automobile 158 emotion 2169 collection 7566 brand 17737
instituutnoord.nlInstituut NoordInstituut Noord – Typen is an educational institute offering individual and group typing courses, primarily for students in grades 6 to 8, and providing support for dyslexia.Driver & Vehicle → Continuing Education 454 computer course 14 type 310 dyslexia 408 course 14728
klaver-snacks.nlKlaver SnacksKlaver Snacks is a catering and rental company that provides snack wagons, BBQ wagons, fish wagons, and other vehicles for events.Quick Bites → Food Trucks 623 snack wagon 24 toilet wagon 29 wagon 133 catering 6456 event 45199
kuilema.nlMakelaardij KuilemaMakelaardij Kuilema’s website is a real estate agency based in Groningen specializing in the sale and purchase of properties, valuations, and assisting clients in finding their dream home.Property Agents & Brokers → Realtors 341 Real Estate → Agencies 243 dream home 59 property listings 88 brokerage 433 valuation 2697 property 7406 Oldambt → Heiligerlee 54
pianofriesland.nlJan van LiereThe website of Jan van Liere offers piano lessons and accompaniment services in Joure and surrounding areas.Guitar → Lessons 165 Music Education → Guitar Lessons 403 accompaniment 18 sheet music 269 piano lessons 346 rate 2606 choir 3123
slotenspecialistfriesland.nlBert RenkemaThe website of Slotenmaker Friesland provides emergency locksmith services and lock repair throughout Friesland, emphasizing reliability, experienced service, and 24/7 availability.Repair → Door Repair 19 Safety & Security → Key Makers 96 key 228 lock 368 friesland 692 locksmith 919 door 2210 security 6655 Southwest-Friesland → Bolsward 566
winbo.nlWinbo Insulation Concrete FloorsThe website of Winbo Insulation Concrete Floors provides information about the supply and application of foam concrete for floor insulation, specifically focusing on crawl space insulation, underfloor heating, and leveling floors.Heating → Underfloor Heating 343 Insulation → Floor Insulation 88 foam concrete 34 floor insulation 104 underfloor heating 757
ydel-design.nlYdel DesignThe website of Ydel Design showcases a freelance graphic designer who helps businesses with branding and design, focusing on clarity, innovation, and custom solutions.Graphic Design → Freelance Graphic Designers 429 rebranding 33 branding 4614 portfolio 6854 design 27202
alecspoor.nlAlec Brendan SpoorThis website is a portfolio of Alec Brendan Spoor, a designer and photographer based in Joure, Friesland, showcasing his work.Technical Aspects → Tutorials 32 photoshop 88 camera 1733 portfolio 6854 photography 9503 design 27202
amooiweer.nlA. Mooiweer KraanverhuurThe website of A. Mooiweer Kraanverhuur presents the services of the company, specializing in crane rental, groundwork and streetwork, with a focus on road construction projects and paving works. The goal is to inform potential customers and request an offer.Construction Machinery → Crane Rental 135 Construction Machinery → Construction Equipment Rental 18 crane rental 68 streetwork 112 drainage 1322 groundwork 1348 paving 1942 Steenwijkerland → Scheerwolde 25
automotiveservicefryslan.nlAutomotive Service FryslânThe Automotive Service Fryslân website is an automotive repair and maintenance business located in Joure, Friesland, offering various services including vehicle inspections (APK), maintenance, air conditioning service, and tire service.Tires → Tire Service 931 Automotive Maintenance → Vehicle Inspection 1102 rental car 178 tire service 180 apk 1333 air conditioning 2178 maintenance 20093
autopoetsenjoure.nlAutopoetsen JoureAutopoetsen Joure is an auto detailing business located in Friesland, offering car polishing and restoration services.Car Care & Detailing → Detailing 941 Maintenance & Services → Car Wash 495 exterior 237 cleaning 4567 interior 8093 car 10865 treatment 21203
autorijschoolbeeksma.nlAutorijschool BeeksmaThe website of Autorijschool Beeksma offers driving lessons in Joure and the surrounding area, with the goal of teaching students to drive relaxed and confidently.Driving & Vehicle → Vehicle Training 553 driving instructor 252 driver’s license 438 driving school 696 driving lessons 2453 environment 4873 student 7623
autorijschoolfolkert.nlAutorijschool FolkertAutorijschool Folkert provides driving lessons in Joure and the surrounding area, offering personalized guidance towards obtaining a driver's license.Driver & Vehicle → Driver’s License 1625 audi 103 driver's license 1283 exam 2120 driving lessons 2453 instructor 3126 package 6112 De Fryske Marren → Sint Nicolaasga 146
b3a.nlB3A – Boermans Bouwmanagement Beheer & AdviesThe website of B3A is a construction management and consulting firm offering services to private and commercial clients, specializing in new construction, renovations, maintenance, restoration, and remodeling.Legal → Construction Law 150 Project Management → Construction Management 1038 damage assessment 28 construction management 199 new construction 2672 consulting 3639 construction 7421 renovation 13849
bnbtinasneek.nlB&B TinaB&B Tina is a luxury bed & breakfast in Sneek, Friesland, offering guests a comfortable stay with amenities like free WiFi and a continental breakfast.Hotels → Boutique Hotels 914 Vacations → City Breaks 536 b&b 1060 wifi 1372 breakfast 1822 terrace 4847 kitchen 6443 Southwest-Friesland → Sneek 1921
boekenwinkel-gids.nlBookshop GuideThe website Bookshop Guide provides an overview of bookstores in various provinces of the Netherlands.Directories → Websites 3473 Context 161394 town 126 bookstore 149 directory 176 province 518 Zwartewaterland → Genemuiden 405
boerderij-info.nlBoerderij-Info B.V.The website boerderij-info.nl is a platform that allows users to search for, discover, and review farms in the Netherlands. It offers services for farms to present their business and sell their products, as well as articles about farms.Business Development → Business Marketing 614 Agriculture → Farms & Farm Businesses 1115 farm 2622 article 6000 Haarlemmermeer → Hoofddorp 2739
bouwservicevandermeer.nlBouwservice van der MeerBouwservice van der Meer is a timber company offering services for carpentry, renovations, and constructions in Friesland.Construction Companies → Timber Companies 178 Installation & Repair → Tradespeople 409 carpentry 2218 construction 7421 quote 12863 renovation 13849 maintenance 20093
boxingdays.nlStichting Joure ActiefThe Winter Events Joure Swingt website provides information and photos about various winter events and Boxing Days held in Joure, Netherlands.Running → Running Events 684 Seasonal & Weather → Winter Events 131 photo 7778 event 45199
brassinc.nlBrass Inc.Brass Inc. is a cover band based in Joure that performs at events.Live Music → Cover Bands 433 Performing Arts → Event Bands 32 brass section 23 musician 1207 repertoire 2497 band 2977 event 45199
cortijnhamstra.nlCortijn HamstraThe website of Cortijn Hamstra, a construction and renovation company, presents the services and projects of the entrepreneur, specializing in new construction, renovations, and alterations of homes and businesses in the Joure region, as well as furniture making.Kitchen → Kitchen Renovations 17 Interior → Furniture 7454 handyman 836 home 7976 furniture 8751 renovation 13849
dapversgras.nlDierenartsenpraktijk Vers GrasDierenartsenpraktijk Vers Gras is a veterinary practice located in Heerenveen with the goal of improving animal health and veterinary care.Veterinarians → Veterinary Clinics 419 Agriculture → Livestock 2413 veterinary practice 71 cattle 167 veterinarian 864 collaboration 16036 Heerenveen → Akkrum 246
deentoeraazje.nlDe EntoeraazjeDe Entoeraazje is a lifestyle shop that offers unique clothing, home accessories, and gifts.Decor & Furnishings → Home Stores 932 Context 161394 home accessories 603 gift 6442 shop 6483 collection 7566 clothing 9443
dejongdakbedekking.nlDe Jong DakbedekkingDe Jong Dakbedekking Oudehaske is a roofing company specializing in new construction, renovation, and maintenance of roofs in Friesland.Roofing → Flat Roofs 54 bitumen 64 damage 1562 roofing 2806 roof 3662 warranty 4701 quote 12863 Southwest-Friesland → Bolsward 566
devriesstukadoors.nlDe Vries StukadoorsDe Vries Stukadoors is a plastering company based in Friesland, Netherlands, offering various plastering services including Beton Cire and decorative plaster.Interior → Wall Finishing 314 Construction Companies → Plasterers 843 beton cire 21 decorative plaster 120 plasterer 259 plaster 2175 Southwest-Friesland → Sneek 1921
diegaststube-joure.nlDie GaststubeThe website 'Die Gaststube' offers online ordering of dishes from the restaurant in Joure.Fast Food → Burger Restaurants 346 Regional Cuisine → German 17 schnitzel 61 sauce 1141
eijl.nlVan Eijl BVVan Eijl BV’s website, operating as FJ08, provides financial services and inspiring workspaces to entrepreneurs.Real Estate → Business Finance 346 Workspace & Office Solutions → Workspace 144 workspace 795 building 3204 finance 5341
ericmeijermechanisatie.nlEric Meijer MechanisatieEric Meijer Mechanisatie provides a wide range of mechanization and repair services for agricultural machinery, cars, trucks, and trailers.Loading & Unloading → Forklifts 257 Machinery & Repair → Mechanization 60 mechanization 49 agricultural machinery 169 truck 1412 car 10865 repair 14576 maintenance 20093 De Fryske Marren → Bantega 19
feestpaalslaan.nlOudbouw-handelFeestpaalslaan.nl is a rental company specializing in the symbolic striking of the first timber pile during construction projects.Creative Spaces & Events → Celebrations 15 milestone 31 event 45199 Southwest-Friesland → Arum 37
fitmeilin.nlFitmeilinThe website of Fitmeilin offers personalized lifestyle coaching in Joure, aimed at helping individuals and groups achieve a healthier and fitter lifestyle, with a particular focus on women going through the transition.Women’s Health → Transition 26 Women’s Health → Menopause 228 lifestyle coaching 339 transition 610 health 6366 energy 9075
grillroommarmaris-joure.nlGrillroom "Marmaris"Grillroom "Marmaris" is a restaurant in Joure that accepts online orders for a comprehensive menu including pizzas, sandwiches, and plates.Ready-To-Eat Meals → Wraps 102 Sandwiches & Salads → Sandwich Shops 229 shawarma 335 plate 787 salad 2444 sandwich 4098 pizza 4158 drink 5191
hazelhoffraamdecoratie.nlHazelhoff RaamdecoratieHazelhoff Raamdecoratie is a window covering specialist based in Friesland, offering custom solutions and advice for both indoor and outdoor shading.Interior → Curtains 831 Interior → Window Coverings 1026 shading 364 curtains 1015 window coverings 1213 Noordoostpolder → Emmeloord 1649
heerlijkclub.nlHEERLIJK ClubThe website offers discount deals on restaurants and culinary experiences throughout the Netherlands.Ticketing & Sales → Packages 35 province 518 dinner 1533 package 6112 restaurant 11215 menu 13856 Oss → Megen 82
heerschapbarbier.nlHeerschap BarbierHeerschap Barbier is a barbershop specializing in the care of men.Men’s Grooming → Barbershops 1012 Fashion → Men’s Fashion 690 shave 179 voucher 279 barber 418 t-shirt 698 haircut 1158
hierbyesther.nlHIER by EstherHIER by Esther is a hair salon located in Joure that provides clients with professional haircuts, advice, and relaxation, with the option of hair extensions.Dermatology → Scalp Care 402 hair extension 384 relaxation 3968 salon 5541 appointment 13510
huitemabouwadvies.nlHuitema Bouw & AdviesThe website of Huitema Bouw & Advies Joure offers construction services and advice to private and business clients, with a focus on new construction and renovations.Construction Companies → Assembly Companies 32 business building 27 construction 7421 house 8121 renovation 13849
jousterfanfareorkest.nlJouster Fanfare OrkestThe website of the Jouster Fanfare Orkest presents the activities, agenda, media and history of the music association, as well as opportunities to support the orchestra.Associations & Societies → Music Associations 1003 Performance → Fanfares 145 youth orchestra 39 conductor 1217 orchestra 1315 sponsorship 2686 agenda 4374 concert 4409 Amsterdam → Sloten 146
kermisrepo.nlMelvin WiersmaKermisrepo.nl is a website that compiles and presents kermissen (carnivals) from the Netherlands and abroad.Directories → Portals 369 Festivals → Carnival 1150 announcement 115 wordpress 3551 Maashorst → Uden 1540
kissnagelenwimpersalon.nlKiss Nagel- en Wimpersalon JoureKiss Nagel- en Wimpersalon Joure is a salon in Joure that offers nail and eyelash extension treatments.Nail Services → Eyebrow Services 62 Beauty → Eyelash Services 1131 eyelash 354 nails 1719 salon 5541 appointment 13510 treatment 21203
klokreparatiejoure.nlFreerk Pasveer - Clock Repair JoureThe website of Freerk Pasveer - Clock Repair Joure offers repair and restoration services for clocks, specializing in Friesian tail- and stool-clock.Crafts → Clockmaking 51 Antiques & Collectibles → Clock Shops 12 timepiece 26 clock 151 technical 291 restoration 3417
kooijschilderwerken.nlKooij SchildersbedrijfKooij Schildersbedrijf is a painting company located in Joure specializing in maintenance, renovation, and sustainable solutions for homes and businesses.Home Improvement & Services → Home Maintenance 1002 sustainable 739 wall 1378 paint 8747 renovation 13849 maintenance 20093 Friesland → Heerenveen 2578
kostentuinman.nlKosten TuinmanThe website ‘Kosten Tuinman’ provides an overview of gardening services in various regions of the Netherlands.Office & Workspace → Business Directories 421 gardener 299 Emmen → Nieuw-Amsterdam 149
kotjoure.nlBiljartvereniging KOT JoureThe website of Biljartvereniging KOT Joure provides information about the association, its competitions, photos, schedules, and historical data.Associations → Sports Associations 1082 Team → Billiards 365 billiard 341 season 692 match 3471 competition 4759 photo 7778 association 8562
lekdetectie-friesland.nlLM BedrijvenThe website of LM Bedrijven aims to inform potential customers in Friesland about and assist them with leak detection in their homes, offering 24/7 emergency service and a damage-free approach.Plumbing → Leak Detection 74 Transportation → Emergency Services 630 detection 128 moisture 227 friesland 692 leak 1204 damage 1562 water 2501 Southwest-Friesland → Bolsward 566
lydiamuller.nlYola de LusenetThe website of Lydia Muller showcases her artwork as a painter and graphic artist, with an emphasis on family genealogy and archives.Social Sciences → Genealogy & Family History 1403 Painting → Individual Artists 668 graphics 123 archive 2067 paintings 3907 exhibition 5332 Wijchen → Diepestraat 50
markt4jou.nlMarkt4jouMarkt4Jou Joure is a shop in Joure that sells second-hand and vintage items, including vinyl, and where individuals can sell their own items and rent a cabinet to store them.Collections & Antiques → Curios 38 Antiques & Collectibles → Vintage 623 vinyl 551 vintage 689 item 1125 cabinet 1730 shop 6483
mfpartyverhuur.nlMijn Feestje Partyverhuur HeerenveenMijn Feestje Partyverhuur Heerenveen is a party rental company that rents various products, including beer tables and party tents, in the Friesland region.Property Rentals → Rental 1169 Logistics & Transportation → Rental Companies 414 beer table 11 heater 184 party tent 256 party 5928 event 45199 Heerenveen → De Knipe 27
minnesmazandgrind.nlZand- en grindhandel MinnesmaZand- en grindhandel Minnesma is a supplier of sand and gravel for various construction purposes, offering options for pickup and delivery, and a concrete station for ready-to-use concrete mix.Building & Materials → Sand 113 Building & Materials → Gravel 131 gravel 302 station 420 sand 630 concrete 973 transport 6105 Friesland → Heerenveen 2578
mlhtrans.nlMLH TransThe website of MLH Trans presents the company as an international transport company specializing in exceptional transport and megatautliner transport.Transportation Services → Refrigerated Transport 226 Freight & Logistics → International Transportation 576 fleet 1351 logistics 3257 transport 6105 Southwest-Friesland → Heeg 227
openingstijden-action.nlOpeningstijden ActionThis website provides current opening hours for all Action stores in the Netherlands.Pharmaceuticals & Medical Products → Pharmacies 1029 Food → Supermarkets & Grocery 3568 action 384 warehouse 1027 database 1153 opening hours 2953 store 3901 The Hague → Scheveningen 1625
osteopathiesteenhuisen.nlOsteopathie SteenhuisenThis website provides information about osteopathy, what a treatment entails, and what indications are available.Physical Therapy → Osteopathy 922 Medical Care & Services → Pediatric & Child Health 2121 indication 164 osteopathy 809 body 3490 complaint 6479 appointment 13510 Southwest-Friesland → Bolsward 566
pcdokter-friesland.nlPC Dokter FrieslandThe website offers computer repair and support services at customers’ homes in Friesland and surrounding areas.Computer → Computer Support 1003 computer 1969 problem 2214 partner 4272 home 7976 repair 14576 workshop 19325 Northeast-Friesland → Dokkum 846
pedicurejudithlenis.nlPedicure salon Judith LenisThe website of Medisch Pedicure Judith Lenis presents her services as a pedicure practice in Joure and surrounding area, specializing in the treatment of various foot problems and the provision of professional pedicure care.Chronic Diseases → Diabetes 349 rheumatism 219 foot problems 320 diabetes 750 pedicure 2196 treatment 21203
pietervandermeulen.nlSanitair & Tegels Pieter van der MeulenSanitair & Tegels Pieter van der Meulen is a tile setter and sanitary ware supplier based in Friesland, specializing in the design and installation of bathrooms and toilets.Contractors → Tiler 164 Bathroom → Sanitary Ware 845 sanitary ware 669 tile 2869 bathroom 3784 quote 12863
pleats18.nlPleats18The website offers a Tinyhouse for rent at Pleats18, a farmhouse located in Vegelinsoord, Friesland, providing a tranquil and unique vacation experience in a rural setting.Alternative Housing → Tiny Houses 161 tiny house 292 farmhouse 878 facility 2616 Friesland → Heerenveen 2578
prijzenverhuisbedrijf.nlPrijzen VerhuisbedrijfThis website provides an overview of moving companies and offers price comparisons.Moving & Storage → Moving 1289 Services → Relocation 206 moving company 178 registration 4366 price 8328 Zwartewaterland → Genemuiden 405
rijschooladam.nlRijschool AdamRijschool Adam is a driving school offering driving lessons and courses in Heerenveen, Drachten, and Joure.Online Services → Web Portals 51 driving license 402 driving lesson 712 instructor 3126 car 10865 course 14728 Smallingerland → Drachten 2052
rvskeukens.nlRVSkeukens.nlThe website RVSkeukens.nl offers custom-made industrial stainless steel island kitchens, focusing on luxury, hygiene, and durability. The company specializes in producing kitchens with a unique process, where the stainless steel surfaces are protected against stains and contamination.Metalworking → Milling 426 Breda → Bavel 264
schoenmakergids.nlschoenmakergids.nlThis website is a directory of shoemakers and locksmiths, organized by province in the Netherlands.Installation & Repair → Tradespeople 409 TravelContent → Travel Guides 938 shoemaker 91 province 518 locksmith 919 city 1875 Raalte → Luttenberg 532
siebegreidanus.nlSealTack B.V.The website of Siebe Greidanus provides expert advice on adhesives and sealing, aimed at businesses in the construction and industrial sectors. The platform functions as an advisory platform with a focus on recommending the right adhesive and sealant solutions.Plastics → Manufacturing 7708 Industry → Industrial 1987 adhesive 244 seal 264 Waadhoeke → Achlum 34
skarboule.nlJeu de Boules Vereniging SkarbouleThe Skarboule Jeu de Boules Vereniging is a recreational and sociable sports association based in Joure, Netherlands, dedicated to the game of Jeu de Boules.Initiatives & Collaboration → Initiatives 459 Team → Team Sports 2401 tournament 2476 association 8562 member 10154
sloepshop.nlSloepshopSloepshop is a specialist in the sale, rental, and configuration of sloeps (small boats) and tenders, offering a wide range of models and accessories and providing personalized service, including delivery service.Boats → Sloops 129 configurator 234 delivery service 236 sloop 272 tender 329 motor 614 showroom 4883
startpuntjoure.nlStichting StartpuntStichting Startpunt Joure provides support and space for start-ups and other businesses.Networking & Collaboration → Starting a Business 274 Office Space → Rental Space 537 office space 773 entrepreneurship 1579 contract 2415 facility 2616 space 3846
streekkracht.nlStreekkracht psychology practiceStreekkracht psychology practice offers psychological support and coaching to adults and young people in the Heerenveen and Joure area.Specialty Medicine → Specialists 158 Medical Care & Services → Psychiatry 756 waiting time 140 insurance provider 157 diagnosis 1490 therapy 7448 practice 9089 coach 25810 Friesland → Heerenveen 2578
taxi-eelco.nlTaxi EelcoThe Taxi Eelco website offers taxi services in and around Joure, Friesland, including regional trips, airport transfers, and online booking options.Taxi & Ride Services → Airport Transportation 365 booking form 18 taxibus 71 tariff 97 taxi 2090 region 5412
taxi-joure.nlTaxi Service JoureTaxi Service Joure provides comfortable and reliable taxi and passenger transportation services in the Joure region, offering various services such as street taxi, catering taxi, healthcare transport, and more.Public Transportation → Regional Transportation 92 passenger transport 40 driver 1832 taxi 2090 rate 2606 Heerenveen → Akkrum 246
taxi2goheerenveen.nlTaxi2Go HeerenveenThe website Taxi Heerenveen eo - Taxi2Go Heerenveen provides taxi services in Heerenveen, Joure, Akkrum, Wolvega and surrounding areas, offering a range of services including general rides and specialized requests such as hospital transport and day care transport.Taxi → Airport Taxi 130 Taxi → Regional Taxis 86 ride 1075 taxi 2090 transport 6105 book 11396 Heerenveen → Akkrum 246
tmbdamwoude.nlTechnisch Montagebedrijf DamwoudeThe website of Technisch Montagebedrijf Damwoude presents the company as a specialist in installation technology and activities in residential and utility construction, with a particular focus on welding, heat pump installation, and the construction of technical spaces. They also offer project management and construction management services.Construction → Building Systems & Services 559 construction management 199 installation technology 223 welding 1051 heat pump 2541 project management 3423 installation 13742 Dantumadiel → Damwâld 153
toeringmode.nlToering ModeToering Mode is a fashion store specializing in women's fashion for women aged 40 and over.Women’s Clothing → Plus Size Fashion 61 Local & Regional Products → Local Shops 245 trousers 275 fashion 2212 brand 17737
utestzelf.nlKurv B.V.U test Zelf is a webshop offering Covid-19 self-tests.Infectious Diseases → COVID-19 98 Pharmaceuticals & Medical Products → Medical Supplies 388 quantity 41 pen 210 test 769 shop 6483 order 6912
vakantie-tjeukemeer.nlVeuger's VakantiewoningenThe website, Vakantie Tjeukemeer, offers holiday accommodations and activities in Friesland, with a focus on the Tjeukemeer and surrounding area, and provides information about events such as the Joure Balloon Festival.Accommodation → Villas 1018 Water Sports → Water Recreation 599 tjeukemeer 11 holiday rental 65 watersport 540 friesland 692 De Fryske Marren → Delfstrahuizen 47
vakantiewoningitskippershus.nlFam. P. van der WerfThis website offers a vacation rental, ‘It Skippershûs’, located in Langweer, Friesland, Netherlands, providing details about the property, its surroundings, and amenities.France → Burgundy 35 Accommodation → Cottages 298 vacation rental 126 water 2501 terrace 4847 renovation 13849 Southwest-Friesland → Sneek 1921
vandellentechniek.nlVan Dellen TechniekThe Van Dellen Techniek website showcases a technical service provider offering installation, maintenance, and technical solutions, with a background in defense and industrial applications.Electric Vehicles → Charging Solutions 26 airbase 12 faults 27 inspection 4279 technology 6816 installation 13742 Northeast-Friesland → Dokkum 846
vanderwagtbouwtechniek.nlVan der Wagt BouwtechniekVan der Wagt Bouwtechniek is an independent construction technical advisory firm specializing in inspecting buildings and overseeing construction projects.Technology & Innovation → Construction Technology 790 Project Management → Construction Supervision 364 quality assurance 144 oversight 164 supervision 1184 inspection 4279 construction 7421 research 8967
vdzschoonmaak.nlSchoonmaakbedrijf Van der ZeeSchoonmaakbedrijf Van der Zee - Glazenwasser is a cleaning and window cleaning company serving the regions of Friesland, Groningen, and Drenthe.Maintenance & Services → Glass Maintenance 371 window cleaning 348 cleaning 4567 quote 12863 sustainability 18451 Aa en Hunze → Rolde 176
waterlevenvijvers.nlWaterlevenThe Waterleven Joure website offers services for the design, maintenance, and renovation of ponds, with a focus on creating natural ponds that support wildlife.Ponds → Pond Maintenance 79 Context → Environment 54437 ecosystem 262 pond 686 renovation 13849 maintenance 20093 design 27202
wespennest-verwijderen-heerenveen.nlBrouwer OngediertebestrijdingThe website of Brouwer Ongediertebestrijding offers services for the removal of wasp nests in various locations in Friesland, with a guarantee and professional approach.Control → Pest Control 824 wasp nest 50 wasps 181 removal 267 control 911 Weststellingwerf → Wolvega 524
woonoutletdewrede.nlWoonvoordeel de WredeWoonvoordeel de Wrede is a furniture and home accessories store.Wedding → Photo Booths 146 Decor & Furnishings → Furniture Retail 46 price guarantee 83 visitors 1048 store 3901 assortment 7799 furniture 8751
wouterrutjes.nlWouter RutjesThe website is a personal website of squash player Wouter Rutjes, showcasing his sporting achievements, goals, and sponsors.Sport Facility → Golf 1441 Activity → Squash 84 squash 91 tournament 2476 goal 4974 Netherlands → Groningen 23734
wurkwize.nlWurkwize B.V.The website Wurkwize is a recruitment agency specializing in placing personnel in various sectors, including transport & logistics, technology, construction, hospitality and manufacturing.Work → Job Search 960 Staffing & Recruitment → Extensive Services 104 recruitment agency 258 job postings 676 personnel 1084 transport 6105 technology 6816 Leeuwarden → Grou 366
yogastudiojoure.nlYoga Studio JoureThe website of Yoga Studio Joure presents the lesson schedule, rates, and background of yoga instructor Nienke van der Grijn, and offers the possibility to book lessons and purchase subscriptions.Yoga → Yoga Studios 358 tea 1146 rate 2606 subscription 3287 yoga 3704 space 3846 lesson 5154
zitgemak.nlZitgemakThe website, Zitgemak in Joure, offers new and almost new standing and relax chairs from various well-known brands, focusing on comfort and quality.Living & Dining → Armchairs 91 Living & Dining → Chairs 393 stock 1154 chair 1223 showroom 4883 brand 17737 Smallingerland → Drachten 2052
zorgclick.nlZorgclickZorgclick provides day care services for people with disabilities in Friesland.Social Services → Caregiving 722 Early Years → Childcare 6029 care 12338 collaboration 16036 Southwest-Friesland → Nijland 39
zussiejoure.nlZussie JoureZussie Joure is a boutique that sells clothing, bags, jewelry, and shoes.Shoes → Women’s Shoes 164 Local & Regional Products → Local Shops 245 boutique 133 bag 2399 shoes 2699 jewelry 4599 clothing 9443
schoenmakerijblom.nlSchoenmakerij BlomSchoenmakerij Blom is a company in Joure that offers repair and maintenance services for shoes, clothing, bags, and leather goods.Repair → Shoe Repair 179 Safety & Security → Key Makers 96 keys 370 bag 2399 shoes 2699 clothing 9443 repair 14576 sustainability 18451
pannenkoeken-thaske.nlPannenkoekenrestaurant 't HaskePannenkoekenrestaurant 't Haske is a family-run restaurant in Joure, Friesland, offering delicious pancakes and various activities for guests of all ages.Family & Themed Dining → Pancakes 49 minigolf 58 jeu de boules 117 play area 173 bowl 482 pancakes 568
fietsenverhuursneek.nlBike Totaal Rodenburg SneekThe website of Bike Totaal Rodenburg Sneek is a bicycle rental company offering city bikes and electric bikes from the Gazelle brand in the area of Sneek, Joure, Lemmer and Rodenburg.Cycling → Bicycle Rental 643 sneekermeer 14 gazelle 34 bike rental 71 bicycle 2838 opening hours 2953 book 11396 De Fryske Marren → Lemmer 1188
keukenbouwer-friesland.nlBob KeukenbouwerBob Keukenbouwer is a kitchen builder based in Friesland offering kitchen designs, equipment, and countertops and providing kitchen renovation services.Kitchen → Kitchen Design 443 Renovation & Restoration → Interior Renovation 879 quooker 55 kitchen appliances 113 3d 131 countertop 179 kitchen 6443 design 27202 De Fryske Marren → Lemmer 1188
zwanenburghovenier.nlHovenier Rick ZwanenburgThe website of Hovenier Rick Zwanenburg offers services for garden maintenance and landscaping in the Friesland region, with a focus on the municipalities of Heerenveen, Sneek, Joure, Grou and Goingarijp.Energy & Sustainability → Green Services 263 garden maintenance 462 landscaping 1529 region 5412 garden 13129 De Fryske Marren → Goingarijp 86
jv-interieurs.nlJV InterieursJV Interieurs is a company specializing in the design, production, and installation of custom interiors for homes, workplaces, and shops.Kitchen → Custom Furniture 473 furniture maker 129 interior 8093 design 27202
hiereensloep.nlFriese Meren Beauty NVThis website offers bookings for boat and ship rentals on the Friesian Lakes, where visitors can sail with an experienced skipper and discover the surroundings of Friesland.Water Travel → Boat Tours 640 skipper 156 lake 352 friesland 692 boat 2980 route 3425
middeldorpbathmen.nlMiddeldorp BathmenThe website of Stefan Middeldorp – Middeldorp Bathmen presents the profile of Stefan Middeldorp, a specialist in water construction and steel dam walls, following the sale of his own company. The aim is to inform potential clients and project partners about his expertise and availability.Civil & Infrastructure → Hydraulic Engineering 85 Civil & Infrastructure → Waterway Construction 45 dam wall 49 water construction 81 turnover 83 communication 10162 Overijssel → Almelo 2696
jsrcustomwheels.nlJSR Custom WheelsJSR Custom Wheels is a company based in Joure, Netherlands, specializing in custom motorcycle wheels and related services.Auto Parts & Tires → Wheels 545 spokes 10 wheel 746 restoration 3417 repair 14576
restaurantfriesland.nlRestaurant FrieslandRestaurant Friesland is a website designed to help users discover, review, and book restaurants in Friesland.Directories → Web Directory 53 Quick Bites → Snack Bar 580 chinese 68 pizzeria 76 friesland 692 review 1888 reservation 3373 restaurant 11215 Northeast-Friesland → Dokkum 846
wodkado.nlN/AThe website presents a list of retailers selling Wodkado Fresh Flavoured Wodka.Gifts & Souvenirs → Liquor Stores 233 Food → Supermarkets & Grocery 3568 liquor store 53 retailer 373 cafe 1622 store 3901 De Fryske Marren → Balk 224
kristavandijk.nlKrista van DijkThe website of Krista van Dijk presents and sells leather bags and wallets, designed and crafted by the designer herself.Crafts → Leatherworking 177 Accessories → Bags 1001 wallet 256 leather 785 gallery 1983 bag 2399 shop 6483 design 27202 De Fryske Marren → Boornzwaag 17
rvdkloet.nlN.V.The website introduces the work and life of Romke van der Kloet, a painter from Lemmer, offering insight into his artistic development and passion.Painting → Acrylic Painting 547 Personal → Personal Stories 1027 oil paint 202 drawing 1101 paint 8747 child 11566 course 14728 Amsterdam → Sloten 146
kostenfeestlocatie.nlkostenfeestlocatie.nlThe website provides an overview of event locations in the Netherlands.Brasseries & Bistros → Brasserie 1005 Travel Agencies → Online Travel Agencies 215 event location 110 compare 582 Southwest-Friesland → Wommels 113
weiwizer.nlWeiwizerThe website presents the profile of Durk Bergsma, a project and program manager with experience in area development, infrastructure, and mobility, and provides information about his services, including strategic advice and involvement in projects such as the Lelylijn Master Plan.Planning & Development → Spatial Planning 889 Civil & Infrastructure → Infrastructure 1033 masterplan 46 urban development 70 area development 219 infrastructure 1460 project management 3423 Friesland → Leeuwarden 6068
witgoedservice-heerenveen.nlWitgoedservice HeerenveenThe website of Witgoedservice Heerenveen offers repair and installation services for household appliances, with a focus on providing quick and professional service in Heerenveen and surrounding areas.Household Appliances → Appliance Repair 224 malfunction 73 appliance 956 equipment 4143 warranty 4701 installation 13742 repair 14576 Heerenveen → Akkrum 246
aedjoure.nlAED Joure FoundationThe AED Joure Foundation aims to make Joure heart-safe by providing AEDs and training citizens.Medical Care & Services → Emergency Response 224 Context → Community 57410 cpr 36 cardiac arrest 75 aed 490
tweelgrondwerken.nlVan den Tweel GrondwerkenVan den Tweel Grondwerken is a ground excavation company providing services in Friesland, specializing in excavation work, profiling, and demolition.Land Development & Earthworks → Excavation Services 13 Land Development & Earthworks → Site Preparation 23 profiling 33 excavation 382 crane 662 demolition 1144 drainage 1322 foundation 6678 De Fryske Marren →  Sintjohannesga 24
wellingtransport.nlWellingtransportWellingtransport is a company offering transport, maintenance, repair, and truck styling services.Freight & Logistics → Truck Transportation 13 Freight & Logistics → Trucks 899 fleet 1351 truck 1412 transport 6105 repair 14576 maintenance 20093
glazenwasserjoure.nlVOF Mulder SchoonmaakThe website of VOF Mulder Schoonmaak presents and promotes the services of a window cleaning and cleaning company, with a focus on the Joure and surrounding area.Cleaning Services → Exterior Cleaning 20 window cleaning 348 gutter 550 facade 1490 office 2898 cleaning 4567 floor 4781 Heerenveen → Akkrum 246
glazenwasserheerenveen.nlVOF Mulder SchoonmaakThe website of VOF Mulder Schoonmaak offers window cleaning and other cleaning services to individuals and businesses in Heerenveen and the surrounding area, emphasizing reliability, safety, and expertise.Maintenance & Services → Glass Maintenance 371 window cleaning 348 facade 1490 office 2898 cleaning 4567 solar panels 4701 floor 4781 De Fryske Marren → Lemmer 1188
stottercentrumfriesland.nlStottercentrum FrieslandStottercentrum Friesland is a center that provides specialized stutter therapy for children and adults.Organizations → Professional Associations 1004 stutter therapy 15 fee 640 practice 9089 child 11566 treatment 21203
heijkenswatersport.nlHeijkens WatersportThe website of Heijkens Watersport offers boat rentals, specifically motorboats, in the picturesque village of Langweer, near Joure in Friesland.Water → Boating 1592 Water Sports → Water Recreation 599 motorboat 128 friesland 692 fleet 1351 rental 7257 De Fryske Marren → Langweer 93
stallinghoman.nlStalling HomanThe website of Stalling Homan offers storage and parking services for various vehicles and recreational equipment in Friesland.Caravans → Caravan Storage 145 Logistics → Storage 1170 friesland 692 caravan 1394 camper 1596 parking 1928 storage 2446 boat 2980 De Fryske Marren → Boornzwaag 17
glazenwasserwolvega.nlVOF Mulder SchoonmaakThe website of VOF Mulder Schoonmaak presents and promotes its window cleaning and cleaning services, with a focus on Wolvega and surrounding areas. The company offers a wide range of cleaning services and emphasizes safety, reliability, and a personalized approach.Maintenance & Services → Glass Maintenance 371 Design & Projects → Self-Employed Entrepreneurs 505 window cleaning 348 gutter 550 facade 1490 office 2898 cleaning 4567 solar panels 4701 Heerenveen → Akkrum 246
witgoedservice-zuidwest-friesland.nlWitgoedservice FrieslandWitgoedservice Friesland offers direct appliance repair services to individuals in Friesland.Household Appliances → Washing Machines 195 Repair → Mobile Phone Repair 1012 issue 214 appliance 956 diagnosis 1490 repair 14576 brand 17737 Dantumadiel → Veenwouden 73
mondhygienefriesland.nlMondhygiëne FrieslandThe website of Mondhygiëne Friesland provides information and allows appointments to be scheduled for dental hygiene treatments, emphasizing personalized attention and the option of home dental care.Dentistry → Oral Hygiene 750 dental hygienist 522 appointment 13510 treatment 21203 Southwest-Friesland → Koudum 134
kammingamultiline.nlKamminga MultilineThe Kamminga Multiline website showcases the company’s services related to professional road marking, with particular focus on zebra crossings and traffic symbols.Road Traffic → Road Marking 16 road marking 22
bouwservice-friesland.nlBouwservice FrieslandBouwservice Friesland is a construction company specializing in new construction, renovation, and carpentry, with a focus on personal service and craftsmanship.Building & Materials → Carpentry & Joinery 830 Renovation & Restoration → Construction Industry 499 carpentry 2218 construction 7421 renovation 13849
hettingabeverages.nlHettinga BeveragesHettinga Beverages is a bottling company specializing in bottling, filling, and producing small to medium-sized batches of beverages.Food & Beverage → Food Industry 835 Business Services → Business Activities 230 filling 121 bottle 300 beverage 586 drink 5191
klavermetaalbewerking.nlKlaver metalworkingThe website of Klaver metalworking presents the services of a company specializing in turning and milling work, metalworking, and welding.Metalworking → Turning 66 Metalworking → Milling 426 turn 226 milling 275 cnc 305 metalworking 565 plastic 1232
boumasbodyshop.nlBouma’s Body ShopBouma’s Body Shop is a specialist in car body repair, painting, and styling located in Joure, Friesland.Maintenance & Repair → Service Businesses 191 styling 2331 paint 8747 car 10865 repair 14576
stratenmakersbedrijfkaspers.nlStratenmakersbedrijf KaspersStratenmakersbedrijf Kaspers is a company that offers various services related to paving, groundwork, and landscaping, primarily in the province of Friesland.Garden → Paving 1003 shed 630 groundwork 1348 landscaping 1529 fence 1814 paving 1942 care 12338 Southwest-Friesland → Bolsward 566
fit-pt.nlFit PTFit PT is a personal training studio located in Drachten and Joure that offers personalized guidance and training sessions.Fitness → CrossFit 282 Fitness → Fitness Studios 354 group training 270 nutrition 4935 health 6366 training 28133 Smallingerland → Drachten 2052
milieustraat-joure.nlMilieustraat SneekThe website provides information about the Milieustraat (recycling center) in Sneek, near Joure, detailing opening hours, accepted waste types, and advantages over municipal recycling centers.Waste Management → Recycling Centers 15 Planning → Local Travel 22 recycling center 20 waste 1312 opening hours 2953 Southwest-Friesland → Sneek 1921
fryslan-foto.nlWilliam Wissink FotografieThe website fryslan-foto.nl presents photographs taken by William Wissink in the province of Friesland, organized by geographical area and municipality.Nature & Landscape → Landscape Photography 530 Painting → Landscape Painting 186 friesland 692 landscape 2609 municipality 6837 photo 7778 photography 9503 De Fryske Marren → Oudehaske 49
goedkoopste-zonnepanelen.nlZonnepaneelhandel B.V.This website provides information about solar panels and related services such as financing, insurance, and subsidies.Loans & Credit → Other Loans 22 loan 832 subsidy 2649 solar panels 4701 insurance 6359 energy 9075 Noordenveld → Roden 621
dekreftcoach.nlDe Krêftcoach PTDe Krêftcoach PT is a personal trainer based in Joure, offering individual training and coaching to help clients achieve their fitness goals.Artists → Studios 152 Fitness → Fitness Studios 354 trainer 1966 goal 4974 studio 5465 blog 13392
rodericklagendijk.nlAcupuncture Drachten – Roderick LagendijkThe website of Acupuncture Drachten – Roderick Lagendijk offers acupuncture treatments in Drachten, focused on resolving physical ailments by stimulating the body’s self-healing capabilities.Emergency & Safety → Alternative Healthcare 567 physical ailments 25 qi 116 holistic 699 acupuncture 1537 therapy 7448 treatment 21203 Smallingerland → Drachten 2052
tijnkramer.nlTijn KramerThis website features travel photos and reflections from the author, Tijn Kramer, about his travels and experiences.Asia → India 23 Travel Stories → Personal Travel Stories 77 india 68 friesland 692 travel 7210
peties.nlPetraThis website presents Petra, a childcare provider in Joure, Friesland, offering care for children aged 0 to 4 years.Early Years → Childcare 6029 friesland 692 childcare 3512 family 6462 child 11566
vexonsecurity.nlVexon SecurityThe website of Vexon Security presents security services to private and public organizations in Friesland and North Netherlands, with a focus on events, hospitality, and crowd management.Event Support & Services → Event Security 64 Security & Surveillance → Security 3251 crowd management 18 hostess 165 hospitality 3491 security 6655 event 45199 Southwest-Friesland → Sneek 1921
heerschapbier.nlHeerschap Bar-BierThe website of Heerschap Bar-Bier presents the craft beers brewed by a barbershop from Joure, focusing on their Tripel and Skearskom, and offers the possibility to order online.Beer → Specialty Beer 113 tripel 14 barbershop 512 beer 2887
aandachtbijschuld.nlAandacht Bij SchuldAandacht Bij Schuld is a bureau that provides financial assistance and support to people facing financial difficulties and debt problems.Financial Assistance → Debt Support 76 Social Services → Community Support 179 budgeting coaching 14 financial difficulties 26 care institution 64 guardianship 767 administration 6587
hsvdebilt.mijnhengelsportvereniging.nlHSV De BiltThe website of HSV De Bilt provides information about the fishing association, with a particular focus on the fly fishing club, and offers updates, photos, and reports on fly fishing activities.Fishing → Fly Fishing 58 fly fishing 19 trophy 145 fishing 424 newsletter 6504 event 45199 Utrecht → De Bilt 1676
titani.nlGoochelaar TitaniThe website of Goochelaar Titani showcases a professional magician specializing in magic tricks with doves, entertainment for events like conferences, fairs, and trade shows, and Table-Magic performances.Magic → Magicians 96 dove 29 magic 258 entertainment 1165 performance 7586 event 45199 Heerde → Wapenveld 203
saxumciviel.nlSaxum CivielSaxum Civiel is a civil construction company specializing in managing and delivering projects in ground, road, and water construction, with a focus on simplifying complex projects and providing straightforward solutions.Civil & Infrastructure → & Waterways 96 Civil & Infrastructure → Bridge Construction 31 complexity 53 contract 2415 South-Holland → Rotterdam 25048
skipsleat.nlBuurtvereniging SkipsleatBuurtvereniging Skipsleat is an organization dedicated to fostering social and cultural connections and improving the quality of life within the Skipsleat neighborhood.Neighborhood Organizations → Residents’ Associations 965 Neighborhood Focus → Neighborhood Activities 187 quality of life 111 neighborhood association 177 neighborhood 2424 member 10154 Opsterland → Terwispel 33